UFSP1 Antibody - BSA Free

Western Blot: UFSP1 Antibody [NBP1-80643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: UFSP1 Antibody [NBP1-80643] - Staining of human rectum shows strong cytoplasmic an membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UFSP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UFSP1 Antibody - BSA Free (NBP1-80643) is a polyclonal antibody validated for use in IHC and WB. Anti-UFSP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADARS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UFSP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UFSP1 Protein (NBP1-80643PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UFSP1 Antibody - BSA Free

• inactive Ufm1-specific protease 1
• UFM1-specific peptidase 1 (non-functional)
• UFSP
• UfSP1

Background

The UFSP1 gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form.Because the human UFS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UFSP1 Antibody (NBP1-80643)(2)

Publications using NBP1-80643

• Missiroli S, Perrone M, GafA R et al. PML at mitochondria-associated membranes governs a trimeric complex with NLRP3 and P2X7R that modulates the tumor immune microenvironment Cell death and differentiation 2022-11-30 [PMID: 36450825] (WB, Mouse)
• Park SH, Yoon SJ, Choi S et al. Particulate matter promotes cancer metastasis through increased HBEGF expression in macrophages Experimental & molecular medicine 2022-11-09 [PMID: 36352257] (WB, Human)

Bioinformatics

• Gene Symbol: UFSP1
• Entrez:
  • 402682(Human)