Ufc1 Antibody (8V0X7)

Western Blot: Ufc1 Antibody (8V0X7) [NBP3-33289] - Western blot analysis of various lysates, using Ufc1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Western Blot: Ufc1 Antibody (8V0X7) [NBP3-33289] - Western blot analysis of various lysates, using Ufc1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 8V0X7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ufc1 Antibody (8V0X7) Summary

• Description: Novus Biologicals Rabbit Ufc1 Antibody (8V0X7) (NBP3-33289) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of Human Ufc1 (NP_057490.2).
  
  Sequence:
  MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: UFC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ufc1 Antibody (8V0X7)

• HSPC155
• ubiquitin-fold modifier conjugating enzyme 1
• ubiquitin-fold modifier-conjugating enzyme 1
• Ufc1
• Ufm1-conjugating enzyme 1

Background

UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1; MIM 610553) (Komatsu et al., 2004 [PubMed 15071506]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UFC1