![Immunohistochemistry-Paraffin: CNIH4 Antibody [NBP1-91797] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://images.novusbio.com/fullsize2/CNIH4-Antibody-Immunohistochemistry-Paraffin-NBP1-91797-img0002.jpg "Immunohistochemistry-Paraffin: CNIH4 Antibody [NBP1-91797] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSH |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CNIH4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NB300-505-img0009.jpg)
-Flow-Cytometry-NB300-505-img0010.jpg)
-Flow-Cytometry-NB300-505-img0011.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0005.jpg)
-Immunohistochemistry-NBP1-78159-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0007.jpg)
-Western-Blot-NBP2-01225-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-01225-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-01225-img0003.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
MIN KANG |
IHC-P | Human | 10/04/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for CNIH4 Antibody (NBP1-91797)Discover more about diseases related to CNIH4 Antibody (NBP1-91797).
|
Research Areas for CNIH4 Antibody (NBP1-91797)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CNIH4 |
-Western-Blot-H00003845-M01-img0011.jpg)
-Western-Blot-H00003845-M01-img0012.jpg)
-Western-Blot-H00003845-M01-img0004.jpg)
-Western-Blot-H00005997-M01-img0007.jpg)
-Knockdown-Validated-H00005997-M01-img0011.jpg)
-Western-Blot-H00005997-M01-img0012.jpg)
![Immunohistochemistry CD46 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD46_AF2005_Immunohistochemistry_6726.jpg)
![Western Blot CD46 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD46_AF2005_Western_Blot_20235.jpg)
-Western-Blot-NBP2-00880-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-00880-img0002.jpg)
-Flow-Cytometry-NBP2-00880-img0003.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
