CNIH4 Antibody

Images

 
Immunohistochemistry-Paraffin: CNIH4 Antibody [NBP1-91797] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNIH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSH
Specificity
Specificity of human CNIH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNIH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNIH4 Protein (NBP1-91797PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-91797 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNIH4 Antibody

  • cornichon homolog 4 (Drosophila)
  • HSPC163
  • protein cornichon homolog 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-01225
Species: Hu
Applications: WB, IHC, IHC-P
H00005997-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA, KD
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00880
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-70653
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
NBP2-13963
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNIH4 Antibody (NBP1-91797) (0)

There are no publications for CNIH4 Antibody (NBP1-91797).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CNIH4 Antibody (NBP1-91797) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-91797:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin CNIH4 NBP1-91797
Enlarge
reviewed by:
Anonymous
IHC-P Human 10/04/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedRetina pigment epithelial cell (RPE)
SpeciesHuman
LotR43432

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNIH4 Antibody (NBP1-91797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CNIH4 Products

Bioinformatics Tool for CNIH4 Antibody (NBP1-91797)

Discover related pathways, diseases and genes to CNIH4 Antibody (NBP1-91797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNIH4 Antibody (NBP1-91797)

Discover more about diseases related to CNIH4 Antibody (NBP1-91797).

Research Areas for CNIH4 Antibody (NBP1-91797)

Find related products by research area.

Blogs on CNIH4

There are no specific blogs for CNIH4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
10/04/2017
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol CNIH4