Novus Biologicals products are now on bio-techne.com

UEVLD Antibody

Images

 
Western Blot: UEVLD Antibody [H00055293-B01P] - Analysis of UEVLD expression in transfected 293T cell line by UEVLD polyclonal antibody. Lane 1: UEV3 transfected lysate(39.27 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UEVLD Antibody Summary

Immunogen
UEVLD (AAH64566.1, 1 a.a. - 357 a.a.) full-length human protein. MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRDIMI
Specificity
UEVLD - UEV and lactate/malate dehyrogenase domains,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UEVLD
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UEVLD Antibody

  • Attp
  • EV and lactate/malate dehydrogenase domain-containing protein
  • signaling molecule ATTP
  • ubiquitin-conjugating enzyme E2 variant 3
  • UEV and lactate/malate dehyrogenase domains
  • UEV-3
  • UEV3FLJ11068

Background

Possible negative regulator of polyubiquitination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14870
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77031
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBL1-16214
Species: Hu
Applications: WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
DADT130
Species: Hu
Applications: ELISA
MAB1144
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NB100-68160
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00005018-D01P
Species: Hu
Applications: ICC/IF, WB
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for UEVLD Antibody (H00055293-B01P) (0)

There are no publications for UEVLD Antibody (H00055293-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UEVLD Antibody (H00055293-B01P) (0)

There are no reviews for UEVLD Antibody (H00055293-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UEVLD Antibody (H00055293-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UEVLD Products

Research Areas for UEVLD Antibody (H00055293-B01P)

Find related products by research area.

Blogs on UEVLD

There are no specific blogs for UEVLD, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UEVLD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UEVLD
Entrez
Uniprot