| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBQLN2. Source: E. coli Amino Acid Sequence: LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | UBQLN2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85639. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Ubiquilin 2 Protein (NBP1-85639PEP)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBQLN2 |
![Western Blot Rad23 Antibody [Unconjugated]](https://images.novusbio.com/images2/Rad23_AF4555_Western_Blot_5498.jpg)
![Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - UBQLN2 shRNA knockdown in SH-SY5Y cells. First lane is the ladder, then treatment with scrambled shRNA and third lane is UBQLN2 knockdown. 30 ug of the protein sample was loaded on the gel and transferred to the nitrocellulose membrane. Overnight incubation in primary antibodies at 4 degrees C in 5 % milk in TBST. Then incubated in secondary antibodies (Goat Anti-mouse DyLight 550) at RT for 2 h, and then imaged. Knockdown of the upper band with shRNA for UBQLN2 was about 82 %, and of the lower band only about 8 %, suggesting a high specificity of the used shRNA. This image was submitted via customer Review.](https://images.novusbio.com/images/Ubiquilin-2-Antibody-5F5-Western-Blot-H00029978-M03-img0012.jpg "Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - UBQLN2 shRNA knockdown in SH-SY5Y cells. First lane is the ladder, then treatment with scrambled shRNA and third lane is UBQLN2 knockdown. 30 ug of the protein sample was loaded on the gel and transferred to the nitrocellulose membrane. Overnight incubation in primary antibodies at 4 degrees C in 5 % milk in TBST. Then incubated in secondary antibodies (Goat Anti-mouse DyLight 550) at RT for 2 h, and then imaged. Knockdown of the upper band with shRNA for UBQLN2 was about 82 %, and of the lower band only about 8 %, suggesting a high specificity of the used shRNA. This image was submitted via customer Review.")