UBE2G1 Antibody

Images

 
Western Blot: UBE2G1 Antibody [NBP2-13499] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: UBE2G1 Antibody [NBP2-13499] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE2G1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY E
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2G1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UBE2G1 Protein (NBP2-13499PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2G1 Antibody

  • E217K
  • EC 6.3.2.19
  • UBC7
  • UBE2G1
  • UBE2GE217K
  • Ubiquitin carrier protein G1
  • ubiquitin-conjugating enzyme E2 G1
  • ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7)
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
  • Ubiquitin-protein ligase G1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NBP2-46270
Species: Hu
Applications: WB, IHC
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-30367
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
E2-616
Species: Hu

Publications for UBE2G1 Antibody (NBP2-13499) (0)

There are no publications for UBE2G1 Antibody (NBP2-13499).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2G1 Antibody (NBP2-13499) (0)

There are no reviews for UBE2G1 Antibody (NBP2-13499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2G1 Antibody (NBP2-13499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2G1 Products

Bioinformatics Tool for UBE2G1 Antibody (NBP2-13499)

Discover related pathways, diseases and genes to UBE2G1 Antibody (NBP2-13499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2G1 Antibody (NBP2-13499)

Discover more about diseases related to UBE2G1 Antibody (NBP2-13499).
 

Pathways for UBE2G1 Antibody (NBP2-13499)

View related products by pathway.

Research Areas for UBE2G1 Antibody (NBP2-13499)

Find related products by research area.

Blogs on UBE2G1

There are no specific blogs for UBE2G1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2G1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2G1
Entrez