UbcH5c/UBE2D3 Antibody - Azide and BSA Free

Western Blot: UbcH5c/UBE2D3 Antibody [NBP2-93898] - Analysis of extracts of various cell lines, using UbcH5c/UBE2D3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 15s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UbcH5c/UBE2D3 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2D3 (NP_003331.1). MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE2D3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for UbcH5c/UBE2D3 Antibody - Azide and BSA Free

• E2(17)KB 3
• E2(17)KB3
• EC 6.3.2.19
• MGC43926
• MGC5416
• UBC4/5
• UBC5C
• UbcH5c
• UBE2D3
• Ubiquitin carrier protein D3
• ubiquitin-conjugating enzyme E2 D3
• Ubiquitin-conjugating enzyme E2(17)KB 3
• Ubiquitin-conjugating enzyme E2-17 kDa 3
• ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5)
• ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
• Ubiquitin-protein ligase D3

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: UBE2D3