UbcH10/UBE2C Antibody

Images

 
Western Blot: UbcH10/UBE2C Antibody [NBP2-56693] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: UbcH10/UBE2C Antibody [NBP2-56693] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UbcH10/UBE2C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
Specificity
Specificity of human UbcH10/UBE2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
UbcH10/UBE2C Knockout HeLa Cell Lysate
Control Peptide
UbcH10/UBE2C Recombinant Protein Antigen (NBP2-56693PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UbcH10/UBE2C Antibody

  • cyclin-selective ubiquitin carrier protein
  • dJ447F3.2
  • EC 6.3.2.19
  • UbcH10
  • UBCH10mitotic-specific ubiquitin-conjugating enzyme
  • UBE2C
  • Ubiquitin carrier protein C
  • ubiquitin carrier protein E2-C
  • ubiquitin-conjugating enzyme E2 C
  • ubiquitin-conjugating enzyme E2C
  • Ubiquitin-protein ligase C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-75659
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20788
Species: Hu
Applications: WB
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UbcH10/UBE2C Antibody (NBP2-56693) (0)

There are no publications for UbcH10/UBE2C Antibody (NBP2-56693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UbcH10/UBE2C Antibody (NBP2-56693) (0)

There are no reviews for UbcH10/UBE2C Antibody (NBP2-56693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UbcH10/UBE2C Antibody (NBP2-56693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UbcH10/UBE2C Products

Bioinformatics Tool for UbcH10/UBE2C Antibody (NBP2-56693)

Discover related pathways, diseases and genes to UbcH10/UBE2C Antibody (NBP2-56693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH10/UBE2C Antibody (NBP2-56693)

Discover more about diseases related to UbcH10/UBE2C Antibody (NBP2-56693).
 

Pathways for UbcH10/UBE2C Antibody (NBP2-56693)

View related products by pathway.

PTMs for UbcH10/UBE2C Antibody (NBP2-56693)

Learn more about PTMs related to UbcH10/UBE2C Antibody (NBP2-56693).
 

Research Areas for UbcH10/UBE2C Antibody (NBP2-56693)

Find related products by research area.

Blogs on UbcH10/UBE2C

There are no specific blogs for UbcH10/UBE2C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH10/UBE2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2C