UAF1/WDR48 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR48. Source: E. coli
Amino Acid Sequence: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
WDR48 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81404. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for UAF1/WDR48 Recombinant Protein Antigen
Background
Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediateddeubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity ofcomplexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnoverwithout increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirussaimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes.Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein(TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptorTCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection bypapillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AC
Publications for UAF1/WDR48 Protein (NBP1-81404PEP) (0)
There are no publications for UAF1/WDR48 Protein (NBP1-81404PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UAF1/WDR48 Protein (NBP1-81404PEP) (0)
There are no reviews for UAF1/WDR48 Protein (NBP1-81404PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for UAF1/WDR48 Protein (NBP1-81404PEP) (0)
Additional UAF1/WDR48 Products
Research Areas for UAF1/WDR48 Protein (NBP1-81404PEP)
Find related products by research area.
|
Blogs on UAF1/WDR48