UAF1/WDR48 Antibody

Images

 
Western Blot: UAF1/WDR48 Antibody [NBP2-49269] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP2-49269] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UAF1/WDR48 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYR
Specificity
Specificity of human UAF1/WDR48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UAF1/WDR48 Recombinant Protein Antigen (NBP2-49269PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UAF1/WDR48 Antibody

  • KIAA1449DKFZp686G1794
  • P80
  • UAF1
  • USP1 associated factor 1
  • USP1-associated factor 1
  • WD repeat domain 48
  • WD repeat endosomal protein
  • WD repeat-containing protein 48
  • WDR48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-49269
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for UAF1/WDR48 Antibody (NBP2-49269) (0)

There are no publications for UAF1/WDR48 Antibody (NBP2-49269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UAF1/WDR48 Antibody (NBP2-49269) (0)

There are no reviews for UAF1/WDR48 Antibody (NBP2-49269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UAF1/WDR48 Antibody (NBP2-49269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UAF1/WDR48 Antibody (NBP2-49269)

Discover related pathways, diseases and genes to UAF1/WDR48 Antibody (NBP2-49269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UAF1/WDR48 Antibody (NBP2-49269)

Discover more about diseases related to UAF1/WDR48 Antibody (NBP2-49269).
 

Pathways for UAF1/WDR48 Antibody (NBP2-49269)

View related products by pathway.

PTMs for UAF1/WDR48 Antibody (NBP2-49269)

Learn more about PTMs related to UAF1/WDR48 Antibody (NBP2-49269).

Blogs on UAF1/WDR48

There are no specific blogs for UAF1/WDR48, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UAF1/WDR48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR48
Entrez