We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

UAF1/WDR48 Antibody

Images

 
Independent Antibodies: Western Blot: UAF1/WDR48 Antibody [NBP2-49269] - Analysis using Anti-WDR48 antibody NBP2-49269 (A) shows similar pattern to independent antibody NBP1-81404 (B).
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP2-49269] - Staining of human skletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP2-49269] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP2-49269] - Staining of human tonsil shows moderate nuclear positivity in subset of non-germinal center cells.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP2-49269] - Staining of human small intestine shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related UAF1/WDR48 Primary Antibodies
Validated by:
 

Independent Antibodies

       

Order Details


    • Catalog Number
      NBP2-49269
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UAF1/WDR48 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYR
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UAF1/WDR48 Antibody

  • KIAA1449DKFZp686G1794
  • P80
  • UAF1
  • USP1 associated factor 1
  • USP1-associated factor 1
  • WD repeat domain 48
  • WD repeat endosomal protein
  • WD repeat-containing protein 48
  • WDR48

Background

Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediateddeubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity ofcomplexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnoverwithout increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirussaimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes.Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein(TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptorTCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection bypapillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DRT100
Species: Hu
Applications: ELISA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02148
Species: Hu
Applications: Flow, ICC/IF, WB
NB100-2559
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6696
Species: Hu, Mu, Rt
Applications: ICC, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
DRT200
Species: Hu
Applications: ELISA
NBP2-49269
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for UAF1/WDR48 Antibody (NBP2-49269) (0)

There are no publications for UAF1/WDR48 Antibody (NBP2-49269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UAF1/WDR48 Antibody (NBP2-49269) (0)

There are no reviews for UAF1/WDR48 Antibody (NBP2-49269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UAF1/WDR48 Antibody (NBP2-49269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UAF1/WDR48 Products

Research Areas for UAF1/WDR48 Antibody (NBP2-49269)

Find related products by research area.

Blogs on UAF1/WDR48

There are no specific blogs for UAF1/WDR48, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UAF1/WDR48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR48