U2AF35 Antibody (1C8)

Images

 
Sandwich ELISA: U2AF35 Antibody (1C8) [H00007307-M01] - Detection limit for recombinant GST tagged U2AF1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

U2AF35 Antibody (1C8) Summary

Immunogen
U2AF1 (NP_006749.1, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACC
Specificity
U2AF1 - U2 small nuclear RNA auxiliary factor 1 (1C8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
U2AF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for U2AF35 Antibody (1C8)

  • FP793
  • human U2 snRNP auxiliary factor small subunit10U2AF35DKFZp313J1712
  • RN
  • RNU2AF1,35-KD subunit
  • U2 auxiliary factor 35 kDa subunit
  • U2 small nuclear RNA auxiliary factor 1
  • U2 small nuclear RNA auxillary factor 1
  • U2 snRNP auxiliary factor small subunit

Background

This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-16432
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB120-13249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-75656
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA, WB
NBP2-15895
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-79848
Species: Hu
Applications: IHC, IHC-P, IP, WB
DRA00B
Species: Hu
Applications: ELISA
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
NBP1-57317
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
H00007307-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for U2AF35 Antibody (H00007307-M01) (0)

There are no publications for U2AF35 Antibody (H00007307-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U2AF35 Antibody (H00007307-M01) (0)

There are no reviews for U2AF35 Antibody (H00007307-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for U2AF35 Antibody (H00007307-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional U2AF35 Products

Bioinformatics Tool for U2AF35 Antibody (H00007307-M01)

Discover related pathways, diseases and genes to U2AF35 Antibody (H00007307-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for U2AF35 Antibody (H00007307-M01)

Discover more about diseases related to U2AF35 Antibody (H00007307-M01).
 

Pathways for U2AF35 Antibody (H00007307-M01)

View related products by pathway.

PTMs for U2AF35 Antibody (H00007307-M01)

Learn more about PTMs related to U2AF35 Antibody (H00007307-M01).
 

Research Areas for U2AF35 Antibody (H00007307-M01)

Find related products by research area.

Blogs on U2AF35

There are no specific blogs for U2AF35, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our U2AF35 Antibody (1C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol U2AF1
Entrez
Uniprot