TYW1 Antibody

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TYW1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYR
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TYW1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TYW1 Antibody

• FLJ10900
• MGC23001
• MGC60291
• Radical S-adenosyl methionine and flavodoxin domain-containing protein 1
• radical S-adenosyl methionine and flavodoxin domains 1
• RSAFD1
• tRNA wybutosine-synthesizing protein 1 homolog
• tRNA-yW synthesizing protein 1 homolog (S. cerevisiae)
• tRNA-yW synthesizing protein 1 homolog A
• tRNA-yW-synthesizing protein
• TYW1A
• YPL207W

Background

Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW1 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TYW1