Tyrosylprotein Sulfotransferase 1/TPST1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE |
| Predicted Species |
Mouse (97%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TPST1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody - BSA Free
Background
TPST1 - tyrosylprotein sulfotransferase 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Neut, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Fe, Hu, RM
Applications: BA, BA
Publications for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody (NBP2-68780) (0)
There are no publications for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody (NBP2-68780).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody (NBP2-68780) (0)
There are no reviews for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody (NBP2-68780).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody (NBP2-68780) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tyrosylprotein Sulfotransferase 1/TPST1 Products
Research Areas for Tyrosylprotein Sulfotransferase 1/TPST1 Antibody (NBP2-68780)
Find related products by research area.
|
Blogs on Tyrosylprotein Sulfotransferase 1/TPST1