OLAH Antibody - BSA Free

Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining in human testis and stomach tissues using anti-OLAH antibody. Corresponding OLAH RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining of human stomach shows low expression as expected.

Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining of human testis shows high expression.

Analysis in control (vector only transfected HEK293T lysate) and OLAH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OLAH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OLAH Antibody - BSA Free (NBP1-83780) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OLAH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OLAH Protein (NBP1-83780PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OLAH Antibody - BSA Free

• EC 3.1.2.14
• FLJ11106
• medium chain
• MGC51852
• oleoyl-ACP hydrolaseAURA1
• SAST
• THEDC1
• thioesterase domain containing 1
• Thioesterase II

Background

In fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released fatty acid is usually C16. However, in the mammary glands of non-ruminant mammals, and in the uropygial gland of certain waterfowl there exists a second thioesterase which releases medium-chain length fatty acids (C8 to C2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OLAH