OLAH Antibody


Western Blot: OLAH Antibody [NBP1-83780] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining in human testis and stomach tissues using anti-OLAH antibody. Corresponding OLAH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining of human stomach shows low expression as expected.
Immunohistochemistry-Paraffin: OLAH Antibody [NBP1-83780] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

OLAH Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLD
Specificity of human OLAH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OLAH Protein (NBP1-83780PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for OLAH Antibody

  • EC
  • FLJ11106
  • medium chain
  • MGC51852
  • oleoyl-ACP hydrolaseAURA1
  • SAST
  • THEDC1
  • thioesterase domain containing 1
  • Thioesterase II


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for OLAH Antibody (NBP1-83780) (0)

There are no publications for OLAH Antibody (NBP1-83780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLAH Antibody (NBP1-83780) (0)

There are no reviews for OLAH Antibody (NBP1-83780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OLAH Antibody (NBP1-83780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OLAH Products

Bioinformatics Tool for OLAH Antibody (NBP1-83780)

Discover related pathways, diseases and genes to OLAH Antibody (NBP1-83780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OLAH Antibody (NBP1-83780)

Discover more about diseases related to OLAH Antibody (NBP1-83780).

Pathways for OLAH Antibody (NBP1-83780)

View related products by pathway.

Blogs on OLAH

There are no specific blogs for OLAH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OLAH Antibody and receive a gift card or discount.


Gene Symbol OLAH