Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-86023] - Staining of human endometrium shows strong granular positivity in cytoplasm in glandular cells.

Immunohistochemistry-Paraffin: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-86023] - Staining of human epididymis shows strong granular positivity in cytoplasm in glandular cells.

Immunohistochemistry-Paraffin: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-86023] - Staining of human liver shows moderate granular positivity in cytoplasm in hepatocytes.

Immunohistochemistry-Paraffin: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-86023] - Staining of human testis shows moderate granular positivity in cytoplasm in Leydig cells.

Immunohistochemistry-Paraffin: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-86023] - Staining of human pancreas shows strong granular positivity in cytoplasm in exocrine glandular cells.

Analysis in human cell line U-2 OS.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free (NBP1-86023) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: IAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGY
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPST2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tyrosylprotein Sulfotransferase 2/TPST2 Protein (NBP1-86023PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

• EC 2.8.2.20
• TPST2
• TPST-2
• tyrosylprotein phosphotransferase 2
• Tyrosylprotein Sulfotransferase 2
• tyrosylprotein sulfotransferase 2protein-tyrosine sulfotransferase 2
• tyrosylprotein sulfotransferase-2

Background

The protein encoded by the TPST2 gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody (NBP1-86023). (Showing 1 - 1 of 1 FAQ).

1. What is the lower limit of detection for TPST2 in Western blot?
   • We generally do not test the limits of detection for our antibodies as this time. I apologize for the inconvenience.

Bioinformatics

• Gene Symbol: TPST2