Recombinant Human TYKi Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TYKi Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 151 - 250 of Human CMPK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG

Protein/Peptide Type
Partial Recombinant Protein
Gene
CMPK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TYKi Protein

  • cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial
  • cytidylate kinase 2
  • EC 2.7.4.14
  • mitochondrial UMP-CMP kinase
  • mitochondrial
  • thymidine monophosphate kinase 2
  • thymidylate kinase family LPS-inducible member
  • TMPK2
  • TYKi
  • UMP-CMPK2

Background

LOC129607 - hypothetical protein LOC129607

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46313
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-63269
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IP
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
AF3155
Species: Mu
Applications: WB, IHC
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC
AF6108
Species: Hu
Applications: IHC
H00129607-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TYKi Partial Recombinant Protein (H00129607-Q01) (0)

There are no publications for TYKi Partial Recombinant Protein (H00129607-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TYKi Partial Recombinant Protein (H00129607-Q01) (0)

There are no reviews for TYKi Partial Recombinant Protein (H00129607-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TYKi Partial Recombinant Protein (H00129607-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TYKi Products

Bioinformatics Tool for TYKi Partial Recombinant Protein (H00129607-Q01)

Discover related pathways, diseases and genes to TYKi Partial Recombinant Protein (H00129607-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TYKi Partial Recombinant Protein (H00129607-Q01)

Discover more about diseases related to TYKi Partial Recombinant Protein (H00129607-Q01).
 

Pathways for TYKi Partial Recombinant Protein (H00129607-Q01)

View related products by pathway.

Research Areas for TYKi Partial Recombinant Protein (H00129607-Q01)

Find related products by research area.

Blogs on TYKi

There are no specific blogs for TYKi, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TYKi Antibody
NBP1-80653

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TYKi Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CMPK2