TXNL1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TXNL1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TXNL1.
  
  

  Source: E. coli

  Amino Acid Sequence: LLLQFQSQWRRGHPAGLSVRMVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TXNL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86900.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TXNL1 Recombinant Protein Antigen

• 32 kDa thioredoxin-related protein
• thioredoxin-like 1
• thioredoxin-like, 32kDa
• thioredoxin-related 32 kDa protein
• thioredoxin-related protein 1
• TRP32thioredoxin-like protein 1
• Txl
• TXL-1
• TXNL

Background

Thioredoxins are a group of small redox active proteins which have a conserved active site sequence. The predicted 32.3-kD protein of TXNL1 (Thioredoxin like protein 1) has 2 distinct domains: an N terminal domain, which is 43% identical to human TXN, and a C terminal domain, which showed no homology to other proteins in the sequence databases. The active site sequence, located within the N terminal domain, is that of a thioredoxin like protein; compared to the active site sequence of TXN, it has a single amino acid substitution. Unlike other thioredoxin like proteins, TXNL1 did not act as a substrate for thioredoxin reductase in an insulin assay.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TXNL1