TXNIP Antibody

Images

 
Western Blot: TXNIP Antibody [NBP1-52909] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: TXNIP Antibody [NBP1-52909] - Human Adult Placenta.
Western Blot: TXNIP Antibody [NBP1-52909] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: TXNIP Antibody [NBP1-52909] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: TXNIP Antibody [NBP1-52909] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Human heart

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TXNIP Antibody Summary

Immunogen
Synthetic peptides corresponding to TXNIP(thioredoxin interacting protein). The peptide sequence was selected from the C terminal of TXNIP (NP_006463). Peptide sequence: DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXNIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TXNIP and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TXNIP Antibody

  • HHCPA78
  • THIF
  • thioredoxin binding protein 2
  • thioredoxin interacting protein
  • Thioredoxin-binding protein 2
  • thioredoxin-interacting protein
  • upregulated by 1,25-dihydroxyvitamin D-3
  • VDUP1EST01027
  • Vitamin D3 up-regulated protein 1

Background

TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1970
Species: Hu
Applications: WB, Simple Western, IHC
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB600-248
Species: Hu
Applications: WB, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-88617
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF4186
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF3254
Species: Hu, Mu, Rt
Applications: WB

Publications for TXNIP Antibody (NBP1-52909) (0)

There are no publications for TXNIP Antibody (NBP1-52909).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNIP Antibody (NBP1-52909) (0)

There are no reviews for TXNIP Antibody (NBP1-52909). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNIP Antibody (NBP1-52909) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNIP Products

Bioinformatics Tool for TXNIP Antibody (NBP1-52909)

Discover related pathways, diseases and genes to TXNIP Antibody (NBP1-52909). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNIP Antibody (NBP1-52909)

Discover more about diseases related to TXNIP Antibody (NBP1-52909).
 

Pathways for TXNIP Antibody (NBP1-52909)

View related products by pathway.

PTMs for TXNIP Antibody (NBP1-52909)

Learn more about PTMs related to TXNIP Antibody (NBP1-52909).

Blogs on TXNIP

There are no specific blogs for TXNIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNIP
Entrez
Uniprot