Recombinant Human TXNDC3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TXNDC3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 530-586 of Human TXNDC3

Source: Wheat Germ

Amino Acid Sequence: AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NME8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
32.01 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TXNDC3 Protein

  • CILD6Sptrx-2
  • EC 2.1.1.31
  • EC 2.5.1.6
  • NM23-H8
  • NME8thioredoxin domain-containing protein 3
  • Spermatid-specific thioredoxin-2
  • sperm-specific thioredoxin 2
  • SPTRX2sptrx-2
  • thioredoxin domain containing 3 (spermatozoa)

Background

TXNDC3 - thioredoxin domain containing 3 (spermatozoa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-80724
Species: Hu
Applications: IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-49883
Species: Hu, Mu, Bv, Ca, Mk, Rb
Applications: IHC, IHC-P, PEP-ELISA
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30535
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-65123
Species: Hu
AF592
Species: Mu
Applications: WB, IHC
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
H00051314-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TXNDC3 Partial Recombinant Protein (H00051314-Q01) (0)

There are no publications for TXNDC3 Partial Recombinant Protein (H00051314-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNDC3 Partial Recombinant Protein (H00051314-Q01) (0)

There are no reviews for TXNDC3 Partial Recombinant Protein (H00051314-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNDC3 Partial Recombinant Protein (H00051314-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TXNDC3 Products

Bioinformatics Tool for TXNDC3 Partial Recombinant Protein (H00051314-Q01)

Discover related pathways, diseases and genes to TXNDC3 Partial Recombinant Protein (H00051314-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNDC3 Partial Recombinant Protein (H00051314-Q01)

Discover more about diseases related to TXNDC3 Partial Recombinant Protein (H00051314-Q01).
 

Pathways for TXNDC3 Partial Recombinant Protein (H00051314-Q01)

View related products by pathway.

Blogs on TXNDC3

There are no specific blogs for TXNDC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TXNDC3 Antibody
NBP1-85616

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TXNDC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NME8