TXNDC3 Antibody (1G5) - Azide and BSA Free

Western Blot: TXNDC3 Antibody (1G5) [H00051314-M01] - TXNDC3 monoclonal antibody (M01), clone 1G5. Analysis of TXNDC3 expression in Jurkat.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1G5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TXNDC3 Antibody (1G5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TXNDC3 Antibody (1G5) - Azide and BSA Free (H00051314-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TXNDC3 (NP_057700, 530 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE
• Specificity: TXNDC3 - thioredoxin domain containing 3 (spermatozoa) (1G5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NME8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TXNDC3 Antibody (1G5) - Azide and BSA Free

• CILD6Sptrx-2
• EC 2.1.1.31
• EC 2.5.1.6
• NM23-H8
• NME8thioredoxin domain-containing protein 3
• Spermatid-specific thioredoxin-2
• sperm-specific thioredoxin 2
• SPTRX2sptrx-2
• thioredoxin domain containing 3 (spermatozoa)

Background

TXNDC3 encodes a group II thioredoxin protein, composed of a thioredoxin domain and 3 NDP kinase domains, with testis-specific expression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NME8
• Entrez:
  • 51314(Human)
• Uniprot:
  • NP_057700(Human)