Tsukushi/TSK Antibody - BSA Free

Western Blot: Tsukushi/TSK Antibody [NBP3-09622] - Western blot analysis of Tsukushi/TSK in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Tsukushi/TSK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tsukushi/TSK Antibody - BSA Free (NBP3-09622) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Tsukushi/TSK (NP_056331). Peptide sequence ALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGPTIL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSKU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Tsukushi/TSK Antibody - BSA Free

• E2IG4
• E2IG4E2-induced gene 4 protein
• leucine rich repeat containing 54
• Leucine-rich repeat-containing protein 54
• LRRC54
• TSK
• TSKtsukushi homolog
• TSKU
• tsukushi small leucine rich proteoglycan homolog (Xenopus laevis)
• Tsukushi
• tsukushi, small leucine rich proteoglycan
• tsukushin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSKU