TSTA3 Antibody

Images

 
Western Blot: TSTA3 Antibody [NBP1-59130] - Hela, Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Immunocytochemistry/ Immunofluorescence: TSTA3 Antibody [NBP1-59130] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue ...read more
Western Blot: TSTA3 Antibody [NBP1-59130] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: TSTA3 Antibody [NBP1-59130] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSTA3 Antibody Summary

Immunogen
Synthetic peptides corresponding to TSTA3(tissue specific transplantation antigen P35B) The peptide sequence was selected from the N terminal of TSTA3. Peptide sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSTA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Application Notes
This is a rabbit polyclonal antibody against TSTA3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSTA3 Antibody

  • EC 1.1.1.271
  • FX
  • GDP-4-keto-6-deoxy-D-mannose epimerase-reductase
  • GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
  • GDP-L-fucose synthase
  • P35B
  • Protein FX
  • Red cell NADP(H)-binding protein
  • SDR4E13-5 epimerase/4-reductase
  • short chain dehydrogenase/reductase family 4E, member 1
  • Short-chain dehydrogenase/reductase family 4E member 1
  • tissue specific transplantation antigen 3
  • tissue specific transplantation antigen P35B
  • Tissue-specific transplantation antigen-3

Background

Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
DTFP10
Species: Hu
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-76966
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59130
Species: Hu, Mu, Rt, Ca, Eq, Gp, Rb
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TSTA3 Antibody (NBP1-59130) (0)

There are no publications for TSTA3 Antibody (NBP1-59130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSTA3 Antibody (NBP1-59130) (0)

There are no reviews for TSTA3 Antibody (NBP1-59130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSTA3 Antibody (NBP1-59130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSTA3 Products

Bioinformatics Tool for TSTA3 Antibody (NBP1-59130)

Discover related pathways, diseases and genes to TSTA3 Antibody (NBP1-59130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSTA3 Antibody (NBP1-59130)

Discover more about diseases related to TSTA3 Antibody (NBP1-59130).
 

Pathways for TSTA3 Antibody (NBP1-59130)

View related products by pathway.

PTMs for TSTA3 Antibody (NBP1-59130)

Learn more about PTMs related to TSTA3 Antibody (NBP1-59130).

Blogs on TSTA3

There are no specific blogs for TSTA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSTA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSTA3
Uniprot