TSTA3 Antibody

Western Blot: TSTA3 Antibody [NBP1-59130] - Hela, Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Immunocytochemistry/Immunofluorescence: TSTA3 Antibody [NBP1-59130] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution P

Western Blot: TSTA3 Antibody [NBP1-59130] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Western Blot: TSTA3 Antibody [NBP1-59130] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

• Reactivity: Hu, Mu, Rt, Ca, Eq, Gp, Rb
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TSTA3 Antibody Summary

• Immunogen: Synthetic peptides corresponding to TSTA3(tissue specific transplantation antigen P35B) The peptide sequence was selected from the N terminal of TSTA3. Peptide sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSTA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
• Application Notes: This is a rabbit polyclonal antibody against TSTA3 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSTA3 Antibody

• EC 1.1.1.271
• FX
• GDP-4-keto-6-deoxy-D-mannose epimerase-reductase
• GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
• GDP-L-fucose synthase
• P35B
• Protein FX
• Red cell NADP(H)-binding protein
• SDR4E13-5 epimerase/4-reductase
• short chain dehydrogenase/reductase family 4E, member 1
• Short-chain dehydrogenase/reductase family 4E member 1
• tissue specific transplantation antigen 3
• tissue specific transplantation antigen P35B
• Tissue-specific transplantation antigen-3

Background

Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSTA3
• Uniprot:
  • Q13630(Human)