TSTA3 Antibody

Images

 
Western Blot: TSTA3 Antibody [H00007264-D01P] - Analysis of TSTA3 expression in transfected 293T cell line by TSTA3 polyclonal antibody.Lane 1: TSTA3 transfected lysate(35.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSTA3 Antibody Summary

Immunogen
TSTA3 (NP_003304.1, 1 a.a. - 321 a.a.) full-length human protein. MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Specificity
TSTA3 - tissue specific transplantation antigen P35B,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSTA3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSTA3 Antibody

  • EC 1.1.1.271
  • FX
  • GDP-4-keto-6-deoxy-D-mannose epimerase-reductase
  • GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
  • GDP-L-fucose synthase
  • P35B
  • Protein FX
  • Red cell NADP(H)-binding protein
  • SDR4E13-5 epimerase/4-reductase
  • short chain dehydrogenase/reductase family 4E, member 1
  • Short-chain dehydrogenase/reductase family 4E member 1
  • tissue specific transplantation antigen 3
  • tissue specific transplantation antigen P35B
  • Tissue-specific transplantation antigen-3

Background

Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB24601
Species: Hu
Applications: WB, IP, Neut
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-14333
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TSTA3 Antibody (H00007264-D01P) (0)

There are no publications for TSTA3 Antibody (H00007264-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSTA3 Antibody (H00007264-D01P) (0)

There are no reviews for TSTA3 Antibody (H00007264-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSTA3 Antibody (H00007264-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSTA3 Products

Bioinformatics Tool for TSTA3 Antibody (H00007264-D01P)

Discover related pathways, diseases and genes to TSTA3 Antibody (H00007264-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSTA3 Antibody (H00007264-D01P)

Discover more about diseases related to TSTA3 Antibody (H00007264-D01P).
 

Pathways for TSTA3 Antibody (H00007264-D01P)

View related products by pathway.

PTMs for TSTA3 Antibody (H00007264-D01P)

Learn more about PTMs related to TSTA3 Antibody (H00007264-D01P).

Blogs on TSTA3

There are no specific blogs for TSTA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSTA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSTA3
Entrez
Uniprot