TSHR Antibody

Images

 
Western Blot: TSH R Antibody [NBP1-53167] - Jurkat Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 2.5 ug/ml Peptide Concentration: 2.0 ug/ml lysate Quantity: 25ug/ ...read more
Western Blot: TSH R Antibody [NBP1-53167] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSHR Antibody Summary

Immunogen
Synthetic peptides corresponding to TSHR(thyroid stimulating hormone receptor) The peptide sequence was selected from the N terminal of TSHR. Peptide sequence CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSHR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TSHR and was validated on Western blot.
Control
TSHR Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSHR Antibody

  • CHNG1
  • LGR3
  • LGR3hTSHR-I
  • MGC75129
  • seven transmembrane helix receptor
  • thyroid stimulating hormone receptor
  • Thyroid-stimulating hormone receptor
  • thyrotropin receptor
  • thyrotropin receptor-I, hTSHR-I
  • TSH R
  • TSHR
  • TSH-R

Background

TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-97765
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
288-TPN/CF
Species: Hu
NLS1436
Species: Hu, Bv
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
6507-IL/CF
Species: Hu
7270-IL/CF
Species: Hu
NBP1-32440
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, Single Cell Western
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-89781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53167
Species: Hu
Applications: WB

Publications for TSHR Antibody (NBP1-53167) (0)

There are no publications for TSHR Antibody (NBP1-53167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSHR Antibody (NBP1-53167) (0)

There are no reviews for TSHR Antibody (NBP1-53167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSHR Antibody (NBP1-53167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSHR Products

Bioinformatics Tool for TSHR Antibody (NBP1-53167)

Discover related pathways, diseases and genes to TSHR Antibody (NBP1-53167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSHR Antibody (NBP1-53167)

Discover more about diseases related to TSHR Antibody (NBP1-53167).
 

Pathways for TSHR Antibody (NBP1-53167)

View related products by pathway.

PTMs for TSHR Antibody (NBP1-53167)

Learn more about PTMs related to TSHR Antibody (NBP1-53167).
 

Research Areas for TSHR Antibody (NBP1-53167)

Find related products by research area.

Blogs on TSHR

There are no specific blogs for TSHR, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSHR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSHR
Uniprot
COVID-19 update