TSH beta Recombinant Protein Antigen

Images

 
There are currently no images for TSH beta Recombinant Protein Antigen (NBP2-68647PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TSH beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSH beta.

Source: E.coli

Amino Acid Sequence: CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TSHB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68647. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TSH beta Recombinant Protein Antigen

  • thyroid stimulating hormone, beta
  • thyroid-stimulating hormone subunit beta
  • thyrotropin beta chain
  • thyrotropin beta subunit
  • Thyrotropin beta
  • thyrotropin subunit beta
  • TSH beta
  • TSHB
  • TSH-B
  • TSH-BETA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32252
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP2-34183
Species: Hu
Applications: IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
MAB6534
Species: Hu
Applications: WB, ELISA
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt, KO

Publications for TSH beta Recombinant Protein Antigen (NBP2-68647PEP) (0)

There are no publications for TSH beta Recombinant Protein Antigen (NBP2-68647PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSH beta Recombinant Protein Antigen (NBP2-68647PEP) (0)

There are no reviews for TSH beta Recombinant Protein Antigen (NBP2-68647PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TSH beta Recombinant Protein Antigen (NBP2-68647PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional TSH beta Products

Bioinformatics Tool for TSH beta Recombinant Protein Antigen (NBP2-68647PEP)

Discover related pathways, diseases and genes to TSH beta Recombinant Protein Antigen (NBP2-68647PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSH beta Recombinant Protein Antigen (NBP2-68647PEP)

Discover more about diseases related to TSH beta Recombinant Protein Antigen (NBP2-68647PEP).
 

Pathways for TSH beta Recombinant Protein Antigen (NBP2-68647PEP)

View related products by pathway.

PTMs for TSH beta Recombinant Protein Antigen (NBP2-68647PEP)

Learn more about PTMs related to TSH beta Recombinant Protein Antigen (NBP2-68647PEP).
 

Research Areas for TSH beta Recombinant Protein Antigen (NBP2-68647PEP)

Find related products by research area.

Blogs on TSH beta

There are no specific blogs for TSH beta, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TSH beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TSHB
Novus 100% Guarantee