TSC22/TSC22D1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TSC22/TSC22D1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSC22/TSC22D1.

  Source: E. coli

  Amino Acid Sequence: QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TSC22D1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54941.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TSC22/TSC22D1 Recombinant Protein Antigen

• Cerebral protein 2
• Egr5
• KIAA1994
• MGC17597
• Regulatory protein TSC-22
• RP11-269C23.2
• TGFB1I4
• TGFB-stimulated clone 22 homolog
• transforming growth factor beta 1 induced transcript 4
• Transforming growth factor beta-1-induced transcript 4 protein
• transforming growth factor beta-stimulated protein TSC-22
• TSC22 domain family 1
• TSC22 domain family protein 1
• TSC22 domain family, member 1
• TSC22
• TSC22D1
• TSC22DKFZp686O19206

Background

Transforming growth factor-beta-stimulated clone-22 (TSC-22) acts as a transcriptionalregulator to modulate cell growth and differentiation and cell death. TSC-22 contains a leucine zipper domain as well as a nuclear export signal, resulting in cytoplasmic localization in living cells. However, concomitant with the induction of apoptosis, TSC-22 translocates from the cytoplasm to the nucleus and shows transcriptional regulatory activity. TSC-22 acts as a major downstream component in the TGF-beta pathway, and also the PPARgamma signalling pathway. The association of these two pathways with tumor suppression, and the significant downregulation of TSC-22 mRNA in various cancer types, such as brain and salivary gland tumors, imply an antiproliferative role for TSC-22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TSC22D1