CAMTA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CAMTA1 Antibody [NBP1-93620] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CAMTA1 Antibody [NBP1-93620] - Staining of human cerebral cortex shows weak to moderate nuclear and cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CAMTA1 Antibody [NBP1-93620] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli and tubuli.
Immunohistochemistry-Paraffin: CAMTA1 Antibody [NBP1-93620] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: CAMTA1 Antibody [NBP1-93620] - Staining of human cerebellum shows weak to moderate nuclear positivity in cells in molecular layer.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAMTA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTE
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMTA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAMTA1 Protein (NBP1-93620PEP)
Publications
Read Publications using
NBP1-93620 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27402838).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAMTA1 Antibody

  • calmodulin binding transcription activator 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85525
Species: Hu
Applications: IHC, IHC-P, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00004692-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
H00084107-M09
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00023002-M03
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NBP3-12985
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-41371
Species: Hu, Ma
Applications: Flow, IHC, IHC-P, PEP-ELISA
7268-CT
Species: Hu
Applications: BA
H00055735-B01P
Species: Hu
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-60414
Species: Hu
Applications: IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for CAMTA1 Antibody (NBP1-93620)(10)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 4 applications: ICC/IF, IF/IHC, IHC, IHC-P.


Filter By Application
ICC/IF
(1)
IF/IHC
(3)
IHC
(1)
IHC-P
(3)
All Applications
Filter By Species
Human
(5)
Rat
(1)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-93620 Applications Species
Mollet IG, Malm HA, Wendt A et al. Integrator of Stress Responses Calmodulin Binding Transcription Activator 1 (Camta1) Regulates miR-212/miR-132 Expression and Insulin Secretion J. Biol. Chem. 2016-07-08 [PMID: 27402838] (ICC/IF, Rat) ICC/IF Rat
Shibuya R, Matsuyama A, Shiba E et al. CAMTA1 is a useful immunohistochemical marker for diagnosing epithelioid hemangioendothelioma Histopathology 2015-04-16 [PMID: 25879300] (IHC-P, Human) IHC-P Human
Yoo Y, Shin J, Jun E et al. Proposed diagnostic and prognostic markers of primary malignant hepatic vascular neoplasms Research Square 2023-05-18 (IHC, Human) IHC Human
Tsukamoto Y, Futani H, Watanabe T et al. Two cases of WWTR1-CAMTA-1 fusion-positive epithelioid hemangioendotheliomas with extremely different outcomes Human Pathology: Case Reports 2018-11-01 (IHC-P, Human) IHC-P Human
Ravindran A, Said S, Shi M Thinking Beyond the Marrow: Deceptive Presentation of a Rare Malignant Neoplasm Mayo Clinic Proceedings 2022-07-01 [PMID: 35787860] (IF/IHC) IF/IHC
Papke DJ, Sholl LM, Doyle LA et al. Gastroesophageal Glomus Tumors: Clinicopathologic and Molecular Genetic Analysis of 26 Cases With a Proposal for Malignancy Criteria The American journal of surgical pathology 2022-06-15 [PMID: 35703141]
Wei H, Zhen T, Tuo Y et al. Clinicopathologic and molecular features of vascular tumors in a series of 118 cases American journal of translational research 2022-05-15 [PMID: 35702134] (IHC-P, Human) IHC-P Human
Vazzano JL, Patton A, Tinoco G, Iwenofu OH Primary Intranodal Epithelioid Hemangioendothelioma with Molecular Confirmation International journal of surgical pathology 2022-01-31 [PMID: 35098778]
Jung H, Kim HN, Jang Y et al. CAMTA-1 Expression in 24 Cases of Hepatic Epithelioid Hemangioendothelioma in a Single Institute: Diagnostic Utility for Differential Diagnosis from Hepatic Angiosarcoma In Vivo 2019-07-30 [PMID: 31662570] (IF/IHC, Human) IF/IHC Human
Lotfalla Mira M, Folpe Andrew L, Fritchie Karen J et al. Hepatic YAP1-TFE3 Rearranged Epithelioid Hemangioendothelioma. Case Reports in Gastrointestinal Medicine 2019-06-02 [PMID: 31341686] (IF/IHC) IF/IHC

Reviews for CAMTA1 Antibody (NBP1-93620) (0)

There are no reviews for CAMTA1 Antibody (NBP1-93620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CAMTA1 Antibody (NBP1-93620). (Showing 1 - 2 of 2 FAQs).

  1. Is this antibody IgG type?
    • I can confirm that our CAMTA1 antibody with catalogue number NBP1-93620 is a rabbit polyclonal of the isotype IgG.
  2. What is the incubation time for the immunocytochemistry.
    • It is recommended that this antibody is incubated overnight at 4C.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAMTA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMTA1
Entrez
Uniprot