Tryptophan rich protein Antibody (2A3) - Azide and BSA Free

Western Blot: Tryptophan rich protein Antibody (2A3) [H00007485-M04] - WRB monoclonal antibody (M04), clone 2A3 Western Blot analysis of WRB expression in IMR-32 ( Cat # L008V1 ).

ELISA: Tryptophan rich protein Antibody (2A3) [H00007485-M04] - Detection limit for recombinant GST tagged WRB is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Tryptophan rich protein Antibody (2A3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: WRB (NP_004618, 29 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
• Specificity: WRB - tryptophan rich basic protein
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GET1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tryptophan rich protein Antibody (2A3) - Azide and BSA Free

• congenital heart disease 5 protein10tryptophan-rich protein
• FLJ51808
• tryptophan rich basic protein

Background

This gene encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrom congenital heart disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GET1
• Entrez:
  • 7485(Human)
• OMIM:
  • 602915(Human)
• Uniprot:
  • NP_004618(Human)