Recombinant Human Tryptophan Hydroxylase 1/TPH-1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Tryptophan Hydroxylase 1/TPH-1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-117 of Human Tryptophan Hydroxylase 1/TPH-1

Source: Wheat Germ

Amino Acid Sequence: MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDH

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TPH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
38.61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tryptophan Hydroxylase 1/TPH-1 Protein

  • EC 1.14.16
  • EC 1.14.16.4
  • indoleacetic acid-5-hydroxylase
  • L-tryptophan hydroxylase
  • MGC119994
  • TPH
  • TPH-1
  • TPRH
  • TRPH
  • tryptophan 5-hydroxylase 1
  • Tryptophan 5-monooxygenase 1
  • tryptophan hydroxylase (tryptophan 5-monooxygenase)
  • Tryptophan Hydroxylase 1

Background

TPH1 - tryptophan hydroxylase 1 (tryptophan 5-monooxygenase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74555
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-45995
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-174
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, IHC, IHC-P
NLS3921
Species: Hu, Mk, Pm
Applications: IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-43801
Species: Hu
Applications: WB
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00007166-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01) (0)

There are no publications for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01) (0)

There are no reviews for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01)

Discover related pathways, diseases and genes to Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01)

Discover more about diseases related to Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01).
 

Pathways for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01)

View related products by pathway.

PTMs for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01)

Learn more about PTMs related to Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01).
 

Research Areas for Tryptophan Hydroxylase 1/TPH-1 Partial Recombinant Protein (H00007166-Q01)

Find related products by research area.

Blogs on Tryptophan Hydroxylase 1/TPH-1

There are no specific blogs for Tryptophan Hydroxylase 1/TPH-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tryptophan Hydroxylase 1/TPH-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TPH1
Entrez