TRRAP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRRAP Antibody [NBP2-58076] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRRAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
Specificity
Specificity of human TRRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRRAP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
TRRAP Knockout HeLa Cell Lysate
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP2-58076 in the following application:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TRRAP Antibody

  • 350/400 kDa PCAF-associated factor
  • FLJ10671
  • PAF350/400
  • PAF400
  • PAF400STAF40
  • STAF40
  • Tra1 homolog
  • Tra1
  • transformation/transcription domain-associated protein
  • TR-AP
  • TRRAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-104
Species: Hu, Mu, Rt, Ca, Kg
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP2-61882
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
H00008294-P01
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-58076
Species: Hu, Mu
Applications: ICC/IF

Publications for TRRAP Antibody (NBP2-58076) (0)

There are no publications for TRRAP Antibody (NBP2-58076).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TRRAP Antibody (NBP2-58076) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-58076:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Wataru KIMURA
IHC-Fr Mouse 06/30/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAdult heart
SpeciesMouse
Lotr72676

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRRAP Antibody (NBP2-58076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRRAP Products

Array NBP2-58076

Bioinformatics Tool for TRRAP Antibody (NBP2-58076)

Discover related pathways, diseases and genes to TRRAP Antibody (NBP2-58076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRRAP Antibody (NBP2-58076)

Discover more about diseases related to TRRAP Antibody (NBP2-58076).
 

Pathways for TRRAP Antibody (NBP2-58076)

View related products by pathway.

PTMs for TRRAP Antibody (NBP2-58076)

Learn more about PTMs related to TRRAP Antibody (NBP2-58076).
 

Research Areas for TRRAP Antibody (NBP2-58076)

Find related products by research area.

Blogs on TRRAP

There are no specific blogs for TRRAP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Wataru KIMURA
06/30/2018
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol TRRAP
Novus 100% Guarantee