TRRAP Antibody


Immunocytochemistry/ Immunofluorescence: TRRAP Antibody [NBP2-58076] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

TRRAP Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
Specificity of human TRRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
TRRAP Knockout HeLa Cell Lysate
Control Peptide
TRRAP Recombinant Protein Antigen (NBP2-58076PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-58076 in the following application:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TRRAP Antibody

  • 350/400 kDa PCAF-associated factor
  • FLJ10671
  • PAF350/400
  • PAF400
  • PAF400STAF40
  • STAF40
  • Tra1 homolog
  • Tra1
  • transformation/transcription domain-associated protein
  • TR-AP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ChIP, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Species: Hu, Mu
Applications: ICC/IF

Publications for TRRAP Antibody (NBP2-58076) (0)

There are no publications for TRRAP Antibody (NBP2-58076).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TRRAP Antibody (NBP2-58076) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-58076:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
reviewed by:
IHC-Fr Mouse 06/30/2018


Sample TestedAdult heart

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRRAP Antibody (NBP2-58076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TRRAP Products

Array NBP2-58076

Bioinformatics Tool for TRRAP Antibody (NBP2-58076)

Discover related pathways, diseases and genes to TRRAP Antibody (NBP2-58076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRRAP Antibody (NBP2-58076)

Discover more about diseases related to TRRAP Antibody (NBP2-58076).

Pathways for TRRAP Antibody (NBP2-58076)

View related products by pathway.

PTMs for TRRAP Antibody (NBP2-58076)

Learn more about PTMs related to TRRAP Antibody (NBP2-58076).

Research Areas for TRRAP Antibody (NBP2-58076)

Find related products by research area.

Blogs on TRRAP

There are no specific blogs for TRRAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC-Fr
Species: Mouse


Gene Symbol TRRAP