Home » TRRAP » TRRAP Antibodies » TRRAP Antibody

TRRAP Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TRRAP Antibody [NBP2-58076] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: TRRAP Antibody [NBP2-58076] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TRRAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
Specificity
Specificity of human TRRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRRAP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
TRRAP Knockout HeLa Cell Lysate
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP2-58076 in the following application:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TRRAP Antibody

  • 350/400 kDa PCAF-associated factor
  • FLJ10671
  • PAF350/400
  • PAF400
  • PAF400STAF40
  • STAF40
  • Tra1 homolog
  • Tra1
  • transformation/transcription domain-associated protein
  • TR-AP
  • TRRAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(45 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
KAT2A/GCN5 Antibody
NBP2-17017
Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: KAT2A/GCN5 Antibody [NBP2-17017] - Analysis of paraformaldehyde-fixed MCF-7, using antibody at 1:500 dilution.
Western Blot: KAT2A/GCN5 Antibody [NBP2-17017] - Sample (30 ug of whole cell lysate) A: IMR32 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu
Applications: WB, ICC/IF
Airway
Trypsin-like Protease ...
2695-SE
Airway Trypsin-like Protease/HAT/TMPRSS11D
(3 Publications)
Species: Hu
TIP60 Antibody
NBP2-24613
Western Blot: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in human brain lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain and 4) rat brain lysate using this antibody. 25 ug/ml.
Immunohistochemistry-Paraffin: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Simple Western: TIP60 Antibody [NBP2-24613] - Simple Western lane view shows a specific band for TIP60 in 0.2 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone.
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton X-100. Then cells were incubated with anti-ATM (NB100-104) at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(87 Publications)
Species: Hu, Mu, Rt, Ca, Kg
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
H4/n Antibody
(3E7H2)
NBP2-52486
Western Blot: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis using HIST2H4A(20Me) mouse mAb against THP-1 (1) cell lysate.
Immunocytochemistry/Immunofluorescence: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of HeLa cells using HIST2H4A(20Me) mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunohistochemistry-Paraffin: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of paraffin-embedded stomach cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Rhodopsin Antibody
(B630)
NBP2-25160
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important to avoid boiling samples containing this protein in SDS-PAGE sample buffer, as this will result in even more extensive aggregation of the Rhodopsin protein and appearance of more of this high molecular weight material.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
gp96/HSP90B1/GRP94
Antibody (9G10)
NB300-619
Western Blot: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Analysis of 25 ug of Hela (lane 1), C6 (lane 2) and NIH-3T3 (lane 3) lysates.
Immunocytochemistry/Immunofluorescence: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Analysis of Glucose-Regulated Protein 94 using Glucose-Regulated Protein 94 Monoclonal Antibody (9G10) shows staining in NIH-3T3 Cells. Glucose-Regulated Protein 94 (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucose-Regulated Protein 94 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Normal biopsies of deparaffinized Mouse breast tissue.
(1 Publication)
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human colon, duodenum, lymph node and testis using Anti-ADA antibody NBP1-87404 (A) shows similar protein distribution across tissues to independent antibody NBP1-90361 (B).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IP
SMARCA1 Antibody
(2H7B9)
NBP2-61882
Western Blot: SMARCA1 Antibody (2H7B9) [NBP2-61882] - Analysis using SMARCA1 mAb against HEK293 (1) and SMARCA1 (AA: 933-1070)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry-Paraffin: SMARCA1 Antibody (2H7B9) [NBP2-61882] - Analysis of stomach cancer tissues using SMARCA1 mouse mAb with DAB staining.
Flow Cytometry: SMARCA1 Antibody (2H7B9) [NBP2-61882] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
PCAF Antibody
(5E11)
H00008850-M04
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in A-431 (Cat # L015V1).
Immunocytochemistry/Immunofluorescence: PCAF Antibody (5E11) [H00008850-M04] - Analysis of monoclonal antibody to PCAF on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in LNCaP (Cat # L004V1).
(1 Review)
Species: Hu
Applications: WB, ELISA, ICC/IF
Recombinant Human
HIST1H4I Protein
H00008294-P01
SDS-Page: Recombinant Human HIST1H4I Protein [H00008294-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
MCG10 Antibody
NBP1-76729
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Recombinant Human
H4/e Protein
H00008363-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Recombinant Human
H4/d Protein
H00008362-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
H4/h Antibody (6D4)
H00008365-M01
Immunocytochemistry/Immunofluorescence: H4/h Antibody (6D4) [H00008365-M01] - Analysis of monoclonal antibody to HIST1H4H on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: H4/h Antibody (6D4) [H00008365-M01] - Detection limit for recombinant GST tagged HIST1H4H is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, ICC/IF
H4/j
Overexpression Lysate
NBL1-11567
Western Blot: H4/j Overexpression Lysate (Adult Normal) [NBL1-11567] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for H4/j.
Species: Hu
TRRAP Antibody
NBP2-58076
TRRAP Antibody
Species: Hu, Mu
Applications: ICC/IF

Publications for TRRAP Antibody (NBP2-58076) (0)

There are no publications for TRRAP Antibody (NBP2-58076).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TRRAP Antibody (NBP2-58076) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-58076:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Wataru KIMURA
 IHC-Fr Mouse 06/30/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAdult heart
SpeciesMouse
Lotr72676

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRRAP Antibody (NBP2-58076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

TRRAP Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TRRAP Products

Array NBP2-58076

Bioinformatics Tool for TRRAP Antibody (NBP2-58076)

Discover related pathways, diseases and genes to TRRAP Antibody (NBP2-58076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRRAP Antibody (NBP2-58076)

Discover more about diseases related to TRRAP Antibody (NBP2-58076).
 

Pathways for TRRAP Antibody (NBP2-58076)

View related products by pathway.

PTMs for TRRAP Antibody (NBP2-58076)

Learn more about PTMs related to TRRAP Antibody (NBP2-58076).
 

Research Areas for TRRAP Antibody (NBP2-58076)

Find related products by research area.

Blogs on TRRAP

There are no specific blogs for TRRAP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
 
 Wataru KIMURA
06/30/2018
Application: IHC-Fr
Species: Mouse
read this review

Bioinformatics

Gene Symbol TRRAP
Novus 100% Guarantee