TRPV4 Antibody - BSA Free

Images

 
Western Blot: TRPV4 Antibody [NBP2-82366] - Host: Rabbit. Target Name: TRPV4. Sample Type: PANC1. Antibody Dilution: 1.0ug/mlTRPV4 is supported by BioGPS gene expression data to be expressed in PANC1
Immunohistochemistry: TRPV4 Antibody [NBP2-82366] - Rat Hippocamus
Western Blot: TRPV4 Antibody [NBP2-82366] - WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HT1080 cell lysate
Western Blot: TRPV4 Antibody [NBP2-82366] - Host: Rabbit. Target Name: TRPV4. Sample Type: HT1080. Antibody Dilution: 1.0ug/ml
Western Blot: TRPV4 Antibody [NBP2-82366] - Host: Rabbit. Target Name: TRPV4. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

TRPV4 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRPV4. Peptide sequence: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TRPV4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for TRPV4 Antibody - BSA Free

  • CMT2Cosmosensitive transient receptor potential channel 4
  • HMSN2C
  • Osm-9-like TRP channel 4
  • OTRPC4
  • OTRPC4SSQTL1
  • transient receptor potential cation channel subfamily V member 4
  • transient receptor potential cation channel, subfamily V, member 4
  • Transient receptor potential protein 12
  • TRP12
  • TRP12OSM9-like transient receptor potential channel 4
  • TRPV4
  • Vanilloid receptor-like channel 2
  • Vanilloid receptor-like protein 2
  • vanilloid receptor-related osmotically activated channel
  • Vanilloid receptor-related osmotically-activated channel
  • VRL2
  • VRL-2
  • VROAC
  • VR-OAC
  • VROACSPSMA

Background

TRPV4 is a cation-selective channel, activated in response to systemic osmotic pressure. FUNCTION: Non-selective calcium permanent cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification. Also activated by low pH, citrate and phorbol esters. Increase of intracellular Ca(2+) potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism. SUBUNIT: Interacts with calmodulin. Interacts with Map7 and Src family Tyr protein kinases LYN, SRC, FYN, HCK, LCK and YES. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed lung, spleen, kidney, testis, fat, and at very low levels in trigeminal ganglia. SIMILARITY: Belongs to the transient receptor family, TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71774
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-32096
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-12909
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NBP3-33063
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-20989
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB

Publications for TRPV4 Antibody (NBP2-82366) (0)

There are no publications for TRPV4 Antibody (NBP2-82366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPV4 Antibody (NBP2-82366) (0)

There are no reviews for TRPV4 Antibody (NBP2-82366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPV4 Antibody (NBP2-82366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPV4 Products

Array NBP2-82366

Research Areas for TRPV4 Antibody (NBP2-82366)

Find related products by research area.

Blogs on TRPV4.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

OS9: Taking proteins to the ER finish line
The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no...  Read full blog post.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPV4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV4