Reactivity | Hu, RtSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPV4. Peptide sequence: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR The peptide sequence for this immunogen was taken from within the described region. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TRPV4 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 91 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRPV4 Antibody (NBP2-82364)Find related products by research area.
|
Winter is coming, and TRPM8 welcomes the cold! TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds. While TRPM8 is best known for its location in peripheral nerve endings, it has functio... Read full blog post. |
OS9: Taking proteins to the ER finish line The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no... Read full blog post. |
Touch Infographic: From Touch Receptors to the Brain The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TRPV4 |