TRPM3 Recombinant Protein Antigen

Images

 
There are currently no images for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRPM3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPM3

Source: E.coli

Amino Acid Sequence: VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRPM3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21371. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRPM3 Recombinant Protein Antigen

  • EC 2.3.1.31
  • EC 5.99.1.3
  • KIAA1616
  • Long transient receptor potential channel 3
  • LTrpC3
  • LTrpC-3
  • LTRPC3KIAA1616MLSN2GON-2
  • melastatin 2
  • Melastatin-2
  • MLSN2
  • transient receptor potential cation channel subfamily M member 3
  • transient receptor potential cation channel, subfamily M, member 3
  • TRPM3

Background

The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. FUNCTION: Calcium channel mediating constitutive calcium ion entry. Its activity is increased by reduction in extracellular osmolarity, by store depletion and muscarinic receptor activation. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed primarily in the kidney and, at lower levels, in brain, testis, ovary, pancreas and spinal cord. Expression in the brain and kidney was determined at protein level. In the kidney, expressed predominantly in the collecting tubular epithelium in the medulla, medullary rays, and periglomerular regions; in the brain, highest levels are found in the cerebellum, choroid plexus, the locus coeruleus, the posterior thalamus and the substantia nigra. Down-regulated in renal tumors compared to normal kidney.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-52272
Species: Hu
Applications:  IHC-P, WB
NBP2-58415
Species: Hu
Applications: IHC,  IHC-P
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-32096
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP2-88493
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NBP2-12909
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-12919
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-21371PEP
Species: Hu
Applications: AC

Publications for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP) (0)

There are no publications for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP) (0)

There are no reviews for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPM3 Products

Research Areas for TRPM3 Recombinant Protein Antigen (NBP3-21371PEP)

Find related products by research area.

Blogs on TRPM3.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRPM3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM3