TRP7 Antibody - Azide and BSA Free

Western Blot: TRP7 Antibody [NBP2-94388] - Analysis of extracts of various cell lines, using TRP7 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

Product Discontinued

TRP7 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1). YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPC7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TRP7 Antibody - Azide and BSA Free

• hTRP7
• KNP3
• likley ortholog of mouse transient receptor potential cation channel, subfamilyC, member 7
• putative capacitative calcium channel
• short transient receptor potential channel 7
• transient receptor potential cation channel, subfamily C, member 7
• transient receptor potential-related channel 7, a novel putative Ca2+ channelprotein10TRPM2
• Transient receptor protein 7
• TRP7
• TRP-7
• TrpC7

Background

TRP7 is thought to form a receptor-activated non-selective calcium permanent cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG). May also be activated by intracellular calcium store depletion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TRPC7