Tropomodulin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Tropomodulin 1 Antibody [NBP2-13459] - Staining of human salivary gland shows low expression as expected.

Immunohistochemistry-Paraffin: Tropomodulin 1 Antibody [NBP2-13459] - Staining of human heart muscle shows high expression.

Analysis in human heart muscle and salivary gland tissues using Anti-TMOD1 antibody. Corresponding TMOD1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tropomodulin 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tropomodulin 1 Antibody - BSA Free (NBP2-13459) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSNQQYYQALSSSSIMNKEGLNSVIKPTQYK
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMOD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tropomodulin 1 Protein (NBP2-13459PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tropomodulin 1 Antibody - BSA Free

• D9S57E
• Erythrocyte tropomodulin
• E-Tmod
• e-tropomodulin
• TMODETMOD
• tropomodulin 1
• tropomodulin-1

Background

Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament. which in turn defines the geometry of the membrane skeleton. May play an important role in regulating the organization of actin filaments by preferentially binding to a specific tropomyosin isoform at its N-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMOD1