Tropomodulin 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Tropomodulin 1 Antibody [NBP2-13459] Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tropomodulin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSNQQYYQALSSSSIMNKEGLNSVIKPTQYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tropomodulin 1 Protein (NBP2-13459PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tropomodulin 1 Antibody

  • D9S57E
  • Erythrocyte tropomodulin
  • E-Tmod
  • e-tropomodulin
  • TMODETMOD
  • tropomodulin 1
  • tropomodulin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
AF6429
Species: Hu
Applications: WB
NBP2-30648
Species: Hu
Applications: IHC, IHC-P
NBP1-85922
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13459
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Tropomodulin 1 Antibody (NBP2-13459) (0)

There are no publications for Tropomodulin 1 Antibody (NBP2-13459).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tropomodulin 1 Antibody (NBP2-13459) (0)

There are no reviews for Tropomodulin 1 Antibody (NBP2-13459). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tropomodulin 1 Antibody (NBP2-13459) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tropomodulin 1 Products

Bioinformatics Tool for Tropomodulin 1 Antibody (NBP2-13459)

Discover related pathways, diseases and genes to Tropomodulin 1 Antibody (NBP2-13459). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tropomodulin 1 Antibody (NBP2-13459)

Discover more about diseases related to Tropomodulin 1 Antibody (NBP2-13459).
 

Pathways for Tropomodulin 1 Antibody (NBP2-13459)

View related products by pathway.

PTMs for Tropomodulin 1 Antibody (NBP2-13459)

Learn more about PTMs related to Tropomodulin 1 Antibody (NBP2-13459).

Blogs on Tropomodulin 1

There are no specific blogs for Tropomodulin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tropomodulin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMOD1