Tropomodulin 2 Antibody

Images

 
Western Blot: Tropomodulin 2 Antibody [NBP1-87378] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: Tropomodulin 2 Antibody [NBP1-87378] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tropomodulin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMOD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Tropomodulin 2 Protein (NBP1-87378PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tropomodulin 2 Antibody

  • MGC39481
  • Neuronal tropomodulin
  • N-TMOD
  • NTMODtropomodulin-2
  • tropomodulin 2 (neuronal)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00955
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1023
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87426
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP1-87378
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tropomodulin 2 Antibody (NBP1-87378) (0)

There are no publications for Tropomodulin 2 Antibody (NBP1-87378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tropomodulin 2 Antibody (NBP1-87378) (0)

There are no reviews for Tropomodulin 2 Antibody (NBP1-87378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tropomodulin 2 Antibody (NBP1-87378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tropomodulin 2 Products

Bioinformatics Tool for Tropomodulin 2 Antibody (NBP1-87378)

Discover related pathways, diseases and genes to Tropomodulin 2 Antibody (NBP1-87378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tropomodulin 2 Antibody (NBP1-87378)

Discover more about diseases related to Tropomodulin 2 Antibody (NBP1-87378).
 

Pathways for Tropomodulin 2 Antibody (NBP1-87378)

View related products by pathway.

Research Areas for Tropomodulin 2 Antibody (NBP1-87378)

Find related products by research area.

Blogs on Tropomodulin 2

There are no specific blogs for Tropomodulin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tropomodulin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMOD2
Entrez
Uniprot