Tropomodulin 2 Antibody - BSA Free

Western Blot: Tropomodulin 2 Antibody [NBP1-87378] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: Tropomodulin 2 Antibody [NBP1-87378] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli fibrillar center.

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378] - Staining in human cerebral cortex and pancreas tissues using anti-TMOD2 antibody. Corresponding TMOD2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tropomodulin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tropomodulin 2 Antibody - BSA Free (NBP1-87378) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPN
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMOD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Tropomodulin 2 Protein (NBP1-87378PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tropomodulin 2 Antibody - BSA Free

• MGC39481
• Neuronal tropomodulin
• N-TMOD
• NTMODtropomodulin-2
• tropomodulin 2 (neuronal)

Background

Tropomodulin 2 encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMOD2
• Entrez:
  • 29767(Human)
• Uniprot:
  • Q9NZR1(Human)