Tropomodulin 3 Antibody

Images

 
Orthogonal Strategies: Western Blot: Tropomodulin 3 Antibody [NBP1-86870] - Analysis in human cell lines A-549 and HEK293 using anti-TMOD3 antibody. Corresponding TMOD3 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
Western Blot: Tropomodulin 3 Antibody [NBP1-86870] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Tropomodulin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMOD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 25486436). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tropomodulin 3 Protein (NBP1-86870PEP)
Publications
Read Publication using NBP1-86870.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25486436)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tropomodulin 3 Antibody

  • tropomodulin 3 (ubiquitous)
  • tropomodulin-3
  • Ubiquitous tropomodulin
  • UTMOD
  • U-Tmod

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00955
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-95207
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87378
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007170-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-45464
Species: Hu, Mu, Rt
Applications: WB, IHC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-1596
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, Single-Cell Western
NBP2-37959
Species: Hu
Applications: WB, IHC, IHC-P
H00000817-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, KD
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33425
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86632
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58997
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tropomodulin 3 Antibody (NBP1-86870)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Tropomodulin 3 Antibody (NBP1-86870) (0)

There are no reviews for Tropomodulin 3 Antibody (NBP1-86870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tropomodulin 3 Antibody (NBP1-86870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Tropomodulin 3 Products

Bioinformatics Tool for Tropomodulin 3 Antibody (NBP1-86870)

Discover related pathways, diseases and genes to Tropomodulin 3 Antibody (NBP1-86870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tropomodulin 3 Antibody (NBP1-86870)

Discover more about diseases related to Tropomodulin 3 Antibody (NBP1-86870).
 

Pathways for Tropomodulin 3 Antibody (NBP1-86870)

View related products by pathway.

Blogs on Tropomodulin 3

There are no specific blogs for Tropomodulin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tropomodulin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMOD3