Tropomodulin 3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Antibody staining is shown in green.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Staining of human lung shows strong cytoplasmic positivity in pneumocytes.

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Analysis in human cell lines A-549 and HEK293 using Anti-TMOD3 antibody. Corresponding TMOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tropomodulin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tropomodulin 3 Antibody - BSA Free (NBP1-86870) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Tropomodulin 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMOD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Tropomodulin 3 Protein (NBP1-86870PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25486436)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tropomodulin 3 Antibody - BSA Free

• tropomodulin 3 (ubiquitous)
• tropomodulin-3
• Ubiquitous tropomodulin
• UTMOD
• U-Tmod

Background

Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tropomodulin 3 Antibody (NBP1-86870)(1)

Publication using NBP1-86870

• D C Singleton, P Rouhi, C E Zois et al. Hypoxic regulation of RIOK3 is a major mechanism for cancer cell invasion and metastasis. Oncogene 2014-12-08 [PMID: 25486436] (WB)

Bioinformatics

• Gene Symbol: TMOD3