Cardiac Leiomodin Antibody


Immunohistochemistry-Paraffin: Cardiac Leiomodin Antibody [NBP2-30648] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Cardiac Leiomodin Antibody [NBP2-30648] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cardiac Leiomodin Antibody [NBP2-30648] - Staining in human heart muscle and prostate tissues using anti-LMOD2 antibody. Corresponding LMOD2 RNA-seq data are more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Cardiac Leiomodin Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYT
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cardiac Leiomodin Protein (NBP2-30648PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cardiac Leiomodin Antibody

  • C-LMOD
  • Leiomodin 2 (Cardiac)
  • leiomodin-2
  • LMOD2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB

Publications for Cardiac Leiomodin Antibody (NBP2-30648) (0)

There are no publications for Cardiac Leiomodin Antibody (NBP2-30648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cardiac Leiomodin Antibody (NBP2-30648) (0)

There are no reviews for Cardiac Leiomodin Antibody (NBP2-30648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cardiac Leiomodin Antibody (NBP2-30648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Cardiac Leiomodin Products

Bioinformatics Tool for Cardiac Leiomodin Antibody (NBP2-30648)

Discover related pathways, diseases and genes to Cardiac Leiomodin Antibody (NBP2-30648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cardiac Leiomodin Antibody (NBP2-30648)

Discover more about diseases related to Cardiac Leiomodin Antibody (NBP2-30648).

Blogs on Cardiac Leiomodin

There are no specific blogs for Cardiac Leiomodin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cardiac Leiomodin Antibody and receive a gift card or discount.


Gene Symbol LMOD2