Cardiac Leiomodin Antibody

Images

 
Immunohistochemistry-Paraffin: Cardiac Leiomodin Antibody [NBP2-30648] - Staining of human heart muscle shows moderate cytoplasmic and membranous positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cardiac Leiomodin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMOD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cardiac Leiomodin Protein (NBP2-30648PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cardiac Leiomodin Antibody

  • C-LMOD
  • Leiomodin 2 (Cardiac)
  • leiomodin-2
  • LMOD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00955
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-85898
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
AF7164
Species: Hu
Applications: WB

Publications for Cardiac Leiomodin Antibody (NBP2-30648) (0)

There are no publications for Cardiac Leiomodin Antibody (NBP2-30648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cardiac Leiomodin Antibody (NBP2-30648) (0)

There are no reviews for Cardiac Leiomodin Antibody (NBP2-30648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cardiac Leiomodin Antibody (NBP2-30648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cardiac Leiomodin Products

Bioinformatics Tool for Cardiac Leiomodin Antibody (NBP2-30648)

Discover related pathways, diseases and genes to Cardiac Leiomodin Antibody (NBP2-30648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cardiac Leiomodin Antibody (NBP2-30648)

Discover more about diseases related to Cardiac Leiomodin Antibody (NBP2-30648).

Blogs on Cardiac Leiomodin

There are no specific blogs for Cardiac Leiomodin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cardiac Leiomodin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMOD2
Uniprot