TRIM9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRIM9 Antibody [NBP2-58964] - Staining of human cell line RH-30 shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD
Specificity
Specificity of human TRIM9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIM9 Recombinant Protein Antigen (NBP2-58964PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TRIM9 Antibody

  • EC 6.3.2.-
  • KIAA0282homolog of rat RING finger Spring
  • RNF91RING finger protein 91
  • SPRINGE3 ubiquitin-protein ligase TRIM9
  • tripartite motif containing 9
  • tripartite motif-containing 9
  • Tripartite motif-containing protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00022954-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-86929
Species: Hu
Applications: IHC, IHC-P
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-27152
Species: Mu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58964
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for TRIM9 Antibody (NBP2-58964) (0)

There are no publications for TRIM9 Antibody (NBP2-58964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM9 Antibody (NBP2-58964) (0)

There are no reviews for TRIM9 Antibody (NBP2-58964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRIM9 Antibody (NBP2-58964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRIM9 Antibody (NBP2-58964)

Discover related pathways, diseases and genes to TRIM9 Antibody (NBP2-58964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM9 Antibody (NBP2-58964)

Discover more about diseases related to TRIM9 Antibody (NBP2-58964).
 

Pathways for TRIM9 Antibody (NBP2-58964)

View related products by pathway.

Research Areas for TRIM9 Antibody (NBP2-58964)

Find related products by research area.

Blogs on TRIM9

There are no specific blogs for TRIM9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM9