TRIM68 Antibody

Images

 
Western Blot: TRIM68 Antibody [NBP2-88480] - WB Suggested Anti-TRIM68 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate
Immunohistochemistry: TRIM68 Antibody [NBP2-88480] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TRIM68 antibody
Western Blot: TRIM68 Antibody [NBP2-88480] - Host: Rabbit. Target Name: TRIM68. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, EqSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM68 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM68. Peptide sequence: VIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM68
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM68 Antibody

  • EC 6.3.2.-
  • FLJ10369
  • GC109MGC126176
  • RING finger protein 137RNF137
  • Ro/SSA1 related protein
  • SS56E3 ubiquitin-protein ligase TRIM68
  • SS-56SSA protein SS-56
  • tripartite motif containing 68
  • tripartite motif-containing 68
  • Tripartite motif-containing protein 68

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48002
Species: Hu, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56548
Species: Hu
Applications: WB, ICC/IF
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP1-33548
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-51541
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NB100-2596
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, CHIP-SEQ
NBP2-46587
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00051592-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89660
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB120-22207
Species: Hu
Applications: ELISA, IHC, IHC-P
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for TRIM68 Antibody (NBP2-88480) (0)

There are no publications for TRIM68 Antibody (NBP2-88480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM68 Antibody (NBP2-88480) (0)

There are no reviews for TRIM68 Antibody (NBP2-88480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM68 Antibody (NBP2-88480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIM68 Products

Bioinformatics Tool for TRIM68 Antibody (NBP2-88480)

Discover related pathways, diseases and genes to TRIM68 Antibody (NBP2-88480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM68 Antibody (NBP2-88480)

Discover more about diseases related to TRIM68 Antibody (NBP2-88480).
 

Pathways for TRIM68 Antibody (NBP2-88480)

View related products by pathway.

PTMs for TRIM68 Antibody (NBP2-88480)

Learn more about PTMs related to TRIM68 Antibody (NBP2-88480).
 

Research Areas for TRIM68 Antibody (NBP2-88480)

Find related products by research area.

Blogs on TRIM68

There are no specific blogs for TRIM68, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM68 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM68