![Western Blot: TRIM68 Antibody [NBP2-88480] - WB Suggested Anti-TRIM68 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate](http://images.novusbio.com/fullsize2/TRIM68-Antibody-Western-Blot-NBP2-88480-img0002.jpg "Western Blot: TRIM68 Antibody [NBP2-88480] - WB Suggested Anti-TRIM68 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate")
| Reactivity | Hu, Mu, Rt, Po, Bv, EqSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRIM68. Peptide sequence: VIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGS The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Equine (100%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIM68 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for TRIM68 Antibody (NBP2-88480)Discover more about diseases related to TRIM68 Antibody (NBP2-88480).
| Pathways for TRIM68 Antibody (NBP2-88480)View related products by pathway.
|
PTMs for TRIM68 Antibody (NBP2-88480)Learn more about PTMs related to TRIM68 Antibody (NBP2-88480).
| Research Areas for TRIM68 Antibody (NBP2-88480)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRIM68 |
![Immunohistochemistry: TRIM68 Antibody [NBP2-88480] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TRIM68 antibody](http://images.novusbio.com/fullsize2/TRIM68-Antibody-Immunohistochemistry-NBP2-88480-img0001.jpg "Immunohistochemistry: TRIM68 Antibody [NBP2-88480] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TRIM68 antibody")
![Western Blot: TRIM68 Antibody [NBP2-88480] - Host: Rabbit. Target Name: TRIM68. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/TRIM68 Antibody-Western Blot-NBP2-88480-img0003.jpg "Western Blot: TRIM68 Antibody [NBP2-88480] - Host: Rabbit. Target Name: TRIM68. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml")
![Western Blot: SSB Antibody (OTI2C8) [NBP1-48002] - Analysis of extracts (35ug) from 9 different cell lines by using anti-SSB monoclonal antibody.](http://images.novusbio.com/images2/SSB-Antibody-(OTI2C8)-Western-Blot-NBP1-48002-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: SSB Antibody (OTI2C8) [NBP1-48002] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SSB.](http://images.novusbio.com/images2/SSB-Antibody-(OTI2C8)-Immunocytochemistry-Immunofluorescence-NBP1-48002-img0013.jpg)
![Immunohistochemistry-Paraffin: SSB Antibody (OTI2C8) [NBP1-48002] - Staining of paraffin-embedded Human prostate tissue using anti-SSB mouse monoclonal antibody.](http://images.novusbio.com/images2/SSB-Antibody-(OTI2C8)-Immunohistochemistry-Paraffin-NBP1-48002-img0012.jpg)
![Western Blot: Livin Antibody (88C570) [NB100-56548] - detection of Livin in A) Livin transfected cell lysate and B) Molt4 cell lysate. A protein band of apprximate molecular weight of 31 kDa is detected using this antibody.](http://images.novusbio.com/images2/Livin Antibody (88C570)-Western Blot-NB100-56548-img0002.jpg)
![Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/images2/Calreticulin-Antibody-Knockdown-Validated-NB600-101-img0011.jpg)
![Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.](http://images.novusbio.com/images2/Calreticulin-Antibody-Western-Blot-NB600-101-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was conjugated with Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.](http://images.novusbio.com/images2/Calreticulin-Antibody-Immunocytochemistry-Immunofluorescence-NB600-101-img0005.jpg)
![Western Blot: TRIM21/SSA1 Antibody [NBP1-33548] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with SSA1 antibody [C1C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/TRIM21-SSA1-Antibody-Western-Blot-NBP1-33548-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: TRIM21/SSA1 Antibody [NBP1-33548] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.](http://images.novusbio.com/images2/TRIM21-SSA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33548-img0007.jpg)
![Immunohistochemistry-Paraffin: TRIM21/SSA1 Antibody [NBP1-33548] - Paraffin-embedded DLD-1 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/TRIM21-SSA1-Antibody-Immunohistochemistry-Paraffin-NBP1-33548-img0008.jpg)
![Western Blot: TROVE2 Antibody [NBP1-86998] - Analysis in human cell line K562.](http://images.novusbio.com/images2/TROVE2-Antibody-Western-Blot-NBP1-86998-img0003.jpg)
![Immunohistochemistry-Paraffin: TROVE2 Antibody [NBP1-86998] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/images2/TROVE2-Antibody-Immunohistochemistry-Paraffin-NBP1-86998-img0002.jpg)
![Western Blot: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in human brain lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain and 4) rat brain lysate using this antibody. 25 ug/ml.](http://images.novusbio.com/images2/TIP60 Antibody-Western Blot-NBP2-24613-img0002.jpg)
![Immunohistochemistry-Paraffin: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/TIP60 Antibody-Immunohistochemistry-Paraffin-NBP2-24613-img0001.jpg)
![Simple Western: TIP60 Antibody [NBP2-24613] - Simple Western lane view shows a specific band for TIP60 in 0.2 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/TIP60-Antibody-Simple-Western-NBP2-24613-img0003.jpg)
![Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.](http://images.novusbio.com/images2/CD8-Antibody-(53-6.7)-Flow-Cytometry-NBP1-49045-img0014.jpg)
![Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.](http://images.novusbio.com/images2/CD8-Antibody-(53-6.7)-Immunohistochemistry-Paraffin-NBP1-49045-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.](http://images.novusbio.com/images2/CD8-Antibody-(53-6.7)-Immunocytochemistry-Immunofluorescence-NBP1-49045-img0006.jpg)
![Western Blot: Kallikrein 3/PSA Antibody (5A11E9) [NBP1-51541] - Analysis against truncated Prostate Specific Antigen recombinant protein.](http://images.novusbio.com/images2/Kallikrein-3-PSA-Antibody-(5A11E9)-Western-Blot-NBP1-51541-img0012.jpg)
![Immunohistochemistry-Paraffin: Kallikrein 3/PSA Antibody (5A11E9) [NBP1-51541] - Analysis of paraffin-embedded human prostate carcinoma tissues, showing cytoplasmic localization using Prostate Specific Antigen mouse mAb with DAB staining.](http://images.novusbio.com/images2/Kallikrein-3-PSA-Antibody-(5A11E9)-Immunohistochemistry-Paraffin-NBP1-51541-img0011.jpg)
![Flow Cytometry: Kallikrein 3/PSA Antibody (5A11E9) [NBP1-51541] - Flow cytometric analysis of PC-3 cells using Prostate Specific Antigen mouse mAb (right) and negative control (left).](http://images.novusbio.com/images2/Kallikrein-3-PSA-Antibody-(5A11E9)-Flow-Cytometry-NBP1-51541-img0009.jpg)
![Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi](http://images.novusbio.com/images2/Androgen-R-NR3C4-[p-Ser213--p-Ser210]-Antibody-(156C135.2)-Western-Blot-NB100-56603-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Immunocytochemistry-Immunofluorescence-NB100-616-img0005.jpg)
![Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Western-Blot-NB100-616-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Immunocytochemistry-Immunofluorescence-NB100-616-img0008.jpg)
![Western Blot: TIF1 alpha Antibody [NB100-2596] - Detection of Human and Mouse TIF1 Alpha/TRIM24 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-TIF1 Alpha/TRIM24 antibody NB100-2596 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/TIF1-alpha-Antibody-Western-Blot-NB100-2596-img0011.jpg)
![Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NB100-2596] - Section of mouse teratoma. Antibody: Affinity purified rabbit anti-TIF1alpha/TRIM24 used at a dilution of 1:200 (1ug/ml). Detection: DAB](http://images.novusbio.com/images2/TIF1-alpha-Antibody-Immunohistochemistry-Paraffin-NB100-2596-img0013.jpg)
![Chromatin Immunoprecipitation Sequencing: TIF1 alpha Antibody [NB100-2596] - Localization of TIF1 Alpha/TRIM24 Binding Sites by ChIP-sequencing.Chromatin from Breast cancer cell line T47D was immunoprecipitated with anti-TIF1 Alpha/TRIM24 antibody NB100-2596 and analyzed by DNA sequencing. The figure illustrates the peak distribution of TIF1 Alpha/TRIM24 binding within a 250 Kb region of chromosome 19 as detected using anti-TIF1 Alpha/TRIM24 antibody NB100-2596. ChIP-seq validation performed by Active Motif, Carlsbad, CA.](http://images.novusbio.com/images2/TIF1 alpha Antibody-Chromatin Immunoprecipitation Sequencing-NB100-2596-img0014.jpg)
![Western Blot: BTG1 Antibody (4C10) [NBP2-46587] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY BTG 1.](http://images.novusbio.com/images2/BTG1 Antibody (4C10)-Western Blot-NBP2-46587-img0006.jpg)
![Immunohistochemistry: BTG1 Antibody (4C10) [NBP2-46587] - Analysis of Adenocarcinoma of Human endometrium tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/BTG1-Antibody-(4C10)-Immunohistochemistry-NBP2-46587-img0005.jpg)
![Immunohistochemistry: BTG1 Antibody (4C10) [NBP2-46587] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/BTG1-Antibody-(4C10)-Immunohistochemistry-NBP2-46587-img0001.jpg)
![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87217] - Staining of human colon, kidney, liver and testis using Anti-PROS1 antibody NBP1-87217 (A) shows similar protein distribution across tissues to independent antibody NBP1-87218 (B).](http://images.novusbio.com/images2/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87217-img0008.jpg)
![Western Blot: Protein S/PROS1 Antibody [NBP1-87217] - Analysis in human plasma.](http://images.novusbio.com/images2/Protein-S-PROS1-Antibody-Western-Blot-NBP1-87217-img0007.jpg)
![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87217] - Staining of human colon.](http://images.novusbio.com/images2/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87217-img0013.jpg)
![Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.](http://images.novusbio.com/images2/TIF1-gamma-Antibody-(6D1)-Western-Blot-H00051592-M01-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on HeLa cell. Antibody concentration 30 ug/ml.](http://images.novusbio.com/images2/TIF1-gamma-Antibody-(6D1)-Immunocytochemistry-Immunofluorescence-H00051592-M01-img0011.jpg)
![Immunohistochemistry-Paraffin: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/TIF1-gamma-Antibody-(6D1)-Immunohistochemistry-Paraffin-H00051592-M01-img0013.jpg)
![Western Blot: TRIM Antibody [NBP1-89660] - Analysis in control (vector only transfected HEK293T lysate) and TRAT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/TRIM Antibody-Western Blot-NBP1-89660-img0008.jpg)
![Immunohistochemistry-Paraffin: TRIM Antibody [NBP1-89660] - Staining in human lymph node and cerebral cortex tissues using anti-TRAT1 antibody. Corresponding TRAT1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/TRIM-Antibody-Immunohistochemistry-Paraffin-NBP1-89660-img0007.jpg)
![Immunohistochemistry: TRIM Antibody [NBP1-89660] - Staining of human tonsil shows cytoplasmic positivity in lymphoid cells outside the reaction centra.](http://images.novusbio.com/images2/TRIM-Antibody-Immunohistochemistry-NBP1-89660-img0004.jpg)
![Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.](http://images.novusbio.com/images2/ALDH9A1-Antibody-Western-Blot-NBP1-89150-img0009.jpg)
![Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/images2/ALDH9A1-Antibody-Immunohistochemistry-Paraffin-NBP1-89150-img0002.jpg)
![Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.](http://images.novusbio.com/images2/ALDH9A1-Antibody-Western-Blot-NBP1-89150-img0008.jpg)
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NB120-22207] - Immunohistochemical staining with anti-TRIM29 antibody in normal testis tissue at 1:100 dilution.](http://images.novusbio.com/images2/TRIM29 Antibody-Immunohistochemistry-Paraffin-NB120-22207-img0001.jpg)
![Western Blot: KAP1 [p Ser824] Antibody [NB100-2350] - MDA-MB-231 cells were treated with DMSO or Merbarone (100 uM) for 24 hours, whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. KAP1 [p Ser824] Antibody (NB100-2350) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.](http://images.novusbio.com/images2/KAP1-[p-Ser824]-Antibody-Western-Blot-NB100-2350-img0019.jpg)
![Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with EPE (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.](http://images.novusbio.com/images2/KAP1-[p-Ser824]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-2350-img0015.jpg)
![Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB](http://images.novusbio.com/images2/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0014.jpg)
