RPL9 Antibody

Images

 
Western Blot: RPL9 Antibody [NBP1-82853] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RPL9 Antibody [NBP1-82853] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli, cytosol & endoplasmic reticulum.
Immunohistochemistry: RPL9 Antibody [NBP1-82853] - Staining of mouse cerebellum shows positivity in Purkinje cells.
Immunohistochemistry: RPL9 Antibody [NBP1-82853] - Staining of mouse lateral septum shows labelling of neurons.
Immunohistochemistry-Paraffin: RPL9 Antibody [NBP1-82853] - Staining of human hippocampus shows strong positivity in neuronal cell bodies.
Immunohistochemistry: RPL9 Antibody [NBP1-82853] - Staining of mouse hippocampus shows positivity in CA3 pyramidal cell layer.
Immunohistochemistry: RPL9 Antibody [NBP1-82853] - Staining of mouse pons shows immunoreactivity in the reticular nucleus neurons.
Immunohistochemistry-Paraffin: RPL9 Antibody [NBP1-82853] - Staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in neuronal cell bodies.
Immunohistochemistry-Paraffin: RPL9 Antibody [NBP1-82853] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and neurons in the molecular layer.
Immunohistochemistry-Paraffin: RPL9 Antibody [NBP1-82853] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPL9 Protein (NBP1-82853PEP)
Publications
Read Publications using NBP1-82853.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL9 Antibody

  • DKFZp313J1510
  • FLJ27456
  • MGC15545
  • NPC-A-16
  • ribosomal protein L9,60S ribosomal protein L9
  • RPL9P7
  • RPL9P8
  • RPL9P9

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPL9 Antibody (NBP1-82853)(2)

Reviews for RPL9 Antibody (NBP1-82853) (0)

There are no reviews for RPL9 Antibody (NBP1-82853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL9 Antibody (NBP1-82853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL9