TRIM41 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRIM41. Peptide sequence: VQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TRIM41 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for TRIM41 Antibody - BSA Free
Background
Tripartite motif containing protein 41 or E3 ubiquitin-protein ligase TRIM41 (human TRIM41 theoretical molecular weight 72 kDa) is a RING finger domain protein which catalyzes the degradation of protein kinase C (PKC). TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signal transducing genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM41 plays a role in the regulation of innate immunity to viral infections. Hepatitis B virus (HBV) replication is inhibited by TRIM41 in a process dependent on its E3 ligase activity (2, 3). TRIM41 is also involved in the inhibition of influenza A virus (IAV) by ubiquitinating and targeting the influenza nucleoprotein for proteasome degradation (4).
1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758
2. Kong, F., You, H., Kong, D., Zheng, K., & Tang, R. (2019). The interaction of hepatitis B virus with the ubiquitin proteasome system in viral replication and associated pathogenesis. Virology Journal. https://doi.org/10.1186/s12985-019-1183-z
3. van Tol, S., Hage, A., Giraldo, M. I., Bharaj, P., & Rajsbaum, R. (2017). The TRIMendous role of TRIMs in virus-host interactions. Vaccines. https://doi.org/10.3390/vaccines5030023
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for TRIM41 Antibody (NBP2-85992) (0)
There are no publications for TRIM41 Antibody (NBP2-85992).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRIM41 Antibody (NBP2-85992) (0)
There are no reviews for TRIM41 Antibody (NBP2-85992).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRIM41 Antibody (NBP2-85992) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRIM41 Products
Research Areas for TRIM41 Antibody (NBP2-85992)
Find related products by research area.
|
Blogs on TRIM41