RPUSD2 Antibody

Images

 
Western Blot: RPUSD2 Antibody [NBP1-88437] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: RPUSD2 Antibody [NBP1-88437] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPUSD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPUSD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPUSD2 Protein (NBP1-88437PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPUSD2 Antibody

  • C15orf19
  • C18B11 homolog (44.9kD)
  • C18B11
  • chromosome 15 open reading frame 19
  • FLJ31409
  • RNA pseudouridylate synthase domain containing 2
  • RNA pseudouridylate synthase domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32847
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-81227
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83840
Species: Hu
Applications: WB, IHC, IHC-P
MAB7200
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-88437
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RPUSD2 Antibody (NBP1-88437) (0)

There are no publications for RPUSD2 Antibody (NBP1-88437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPUSD2 Antibody (NBP1-88437) (0)

There are no reviews for RPUSD2 Antibody (NBP1-88437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPUSD2 Antibody (NBP1-88437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPUSD2 Products

Bioinformatics Tool for RPUSD2 Antibody (NBP1-88437)

Discover related pathways, diseases and genes to RPUSD2 Antibody (NBP1-88437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPUSD2 Antibody (NBP1-88437)

Discover more about diseases related to RPUSD2 Antibody (NBP1-88437).

Blogs on RPUSD2

There are no specific blogs for RPUSD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPUSD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPUSD2