PLEKHG6 Antibody

Images

 
Western Blot: PLEKHG6 Antibody [NBP1-83840] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: PLEKHG6 Antibody [NBP1-83840] - Staining of human placenta shows strong membranous staining positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHG6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHG6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLEKHG6 Protein (NBP1-83840PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHG6 Antibody

  • FLJ10665
  • pleckstrin homology domain containing, family G (with RhoGef domain) member 6
  • pleckstrin homology domain-containing family G member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP2-46483
Species: Hu
Applications: WB, IHC
H00000389-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88437
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83840
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLEKHG6 Antibody (NBP1-83840) (0)

There are no publications for PLEKHG6 Antibody (NBP1-83840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHG6 Antibody (NBP1-83840) (0)

There are no reviews for PLEKHG6 Antibody (NBP1-83840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHG6 Antibody (NBP1-83840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHG6 Products

Bioinformatics Tool for PLEKHG6 Antibody (NBP1-83840)

Discover related pathways, diseases and genes to PLEKHG6 Antibody (NBP1-83840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHG6 Antibody (NBP1-83840)

Discover more about diseases related to PLEKHG6 Antibody (NBP1-83840).
 

Pathways for PLEKHG6 Antibody (NBP1-83840)

View related products by pathway.

Blogs on PLEKHG6

There are no specific blogs for PLEKHG6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHG6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHG6