TRIM41 Antibody

Images

 
Western Blot: TRIM41 Antibody [NBP2-85988] - WB Suggested Anti-TRIM41 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Liver
Immunohistochemistry: TRIM41 Antibody [NBP2-85988] - Human Pancreas

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM41 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM41. Peptide sequence: AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM41
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM41 Antibody

  • tripartite motif containing 41

Background

Tripartite motif containing protein 41 or E3 ubiquitin-protein ligase TRIM41 (human TRIM41 theoretical molecular weight 72 kDa) is a RING finger domain protein which catalyzes the degradation of protein kinase C (PKC). TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signal transducing genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM41 plays a role in the regulation of innate immunity to viral infections. Hepatitis B virus (HBV) replication is inhibited by TRIM41 in a process dependent on its E3 ligase activity (2, 3). TRIM41 is also involved in the inhibition of influenza A virus (IAV) by ubiquitinating and targeting the influenza nucleoprotein for proteasome degradation (4).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Kong, F., You, H., Kong, D., Zheng, K., & Tang, R. (2019). The interaction of hepatitis B virus with the ubiquitin proteasome system in viral replication and associated pathogenesis. Virology Journal. https://doi.org/10.1186/s12985-019-1183-z

3. van Tol, S., Hage, A., Giraldo, M. I., Bharaj, P., & Rajsbaum, R. (2017). The TRIMendous role of TRIMs in virus-host interactions. Vaccines. https://doi.org/10.3390/vaccines5030023

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-31052
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89112
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-80477
Species: Hu
Applications: IHC, IHC-P, WB
H00008539-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF7550
Species: Hu
Applications: KO, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP2-19020
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
NBP2-02864
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86815
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-00129
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-83840
Species: Hu
Applications: IHC, IHC-P
NBP2-85988
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRIM41 Antibody (NBP2-85988) (0)

There are no publications for TRIM41 Antibody (NBP2-85988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM41 Antibody (NBP2-85988) (0)

There are no reviews for TRIM41 Antibody (NBP2-85988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM41 Antibody (NBP2-85988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM41 Products

Bioinformatics Tool for TRIM41 Antibody (NBP2-85988)

Discover related pathways, diseases and genes to TRIM41 Antibody (NBP2-85988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM41 Antibody (NBP2-85988)

Discover more about diseases related to TRIM41 Antibody (NBP2-85988).
 

Pathways for TRIM41 Antibody (NBP2-85988)

View related products by pathway.

PTMs for TRIM41 Antibody (NBP2-85988)

Learn more about PTMs related to TRIM41 Antibody (NBP2-85988).
 

Research Areas for TRIM41 Antibody (NBP2-85988)

Find related products by research area.

Blogs on TRIM41

There are no specific blogs for TRIM41, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM41