TRIM32 Antibody

Images

 
Western Blot: TRIM32 Antibody [NBP2-13484] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: TRIM32 Antibody [NBP2-13484] - Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: TRIM32 Antibody [NBP2-13484] - Staining of human gallbladder shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITA LPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIM32 Protein (NBP2-13484PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM32 Antibody

  • 72 kDa Tat-interacting protein
  • BBS11
  • BBS1172-KD
  • EC 6.3.2.-
  • HT2A
  • HT2Alimb girdle muscular dystrophy 2H (autosomal recessive)
  • LGMD2H
  • TATIP
  • TRIM32
  • tripartite motif containing 32
  • Zinc finger protein HT2A
  • zinc-finger protein HT2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-55584
Species: Hu
Applications: ICC/IF
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-13484
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM32 Antibody (NBP2-13484) (0)

There are no publications for TRIM32 Antibody (NBP2-13484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM32 Antibody (NBP2-13484) (0)

There are no reviews for TRIM32 Antibody (NBP2-13484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIM32 Antibody (NBP2-13484) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM32 Products

Bioinformatics Tool for TRIM32 Antibody (NBP2-13484)

Discover related pathways, diseases and genes to TRIM32 Antibody (NBP2-13484). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM32 Antibody (NBP2-13484)

Discover more about diseases related to TRIM32 Antibody (NBP2-13484).
 

Pathways for TRIM32 Antibody (NBP2-13484)

View related products by pathway.

PTMs for TRIM32 Antibody (NBP2-13484)

Learn more about PTMs related to TRIM32 Antibody (NBP2-13484).
 

Research Areas for TRIM32 Antibody (NBP2-13484)

Find related products by research area.

Blogs on TRIM32

There are no specific blogs for TRIM32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM32
Entrez