TRIM32 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TRIM32 Antibody [NBP2-13484] - Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments.

Immunohistochemistry-Paraffin: TRIM32 Antibody [NBP2-13484] - Staining of human gallbladder shows strong nuclear and cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Staining of human prostate shows strong nuclear positivity in glandular cells.

Staining of human small intestine shows strong nuclear and cytoplasmic positivity in glandular cells.

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM32 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIM32 Antibody - BSA Free (NBP2-13484) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM32
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRIM32 Protein (NBP2-13484PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIM32 Antibody - BSA Free

• 72 kDa Tat-interacting protein
• BBS11
• BBS1172-KD
• EC 6.3.2.-
• HT2A
• HT2Alimb girdle muscular dystrophy 2H (autosomal recessive)
• LGMD2H
• TATIP
• TRIM32
• tripartite motif containing 32
• Zinc finger protein HT2A
• zinc-finger protein HT2A

Background

TRIM32 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM32