Calpain 3 Antibody (1B2)

Images

 
Immunocytochemistry/ Immunofluorescence: Calpain 3 Antibody (1B2) [H00000825-M01] - Analysis of monoclonal antibody to CAPN3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Calpain 3 Antibody (1B2) [H00000825-M01] - Detection limit for recombinant GST tagged CAPN3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calpain 3 Antibody (1B2) Summary

Immunogen
CAPN3 (AAH03169.1 210 a.a. - 309 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Specificity
Reacts with calpain 3, (p94).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAPN3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain 3 Antibody (1B2)

  • calpain 3, (p94)
  • Calpain L3
  • Calpain p94
  • calpain, large polypeptide L3
  • calpain-3
  • CANP 3
  • CANP3MGC4403
  • CANPL3
  • EC 3.4.22
  • EC 3.4.22.54
  • LGMD2
  • LGMD2A
  • MGC10767
  • MGC11121
  • MGC14344
  • muscle-specific calcium-activated neutral protease 3 large subunit
  • Muscle-specific calcium-activated neutral protease 3
  • NCL1
  • nCL-1large [catalytic] subunit
  • New calpain 1

Background

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-55584
Species: Hu
Applications: ICC/IF
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Calpain 3 Antibody (H00000825-M01) (0)

There are no publications for Calpain 3 Antibody (H00000825-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 3 Antibody (H00000825-M01) (0)

There are no reviews for Calpain 3 Antibody (H00000825-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calpain 3 Antibody (H00000825-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain 3 Products

Bioinformatics Tool for Calpain 3 Antibody (H00000825-M01)

Discover related pathways, diseases and genes to Calpain 3 Antibody (H00000825-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 3 Antibody (H00000825-M01)

Discover more about diseases related to Calpain 3 Antibody (H00000825-M01).
 

Pathways for Calpain 3 Antibody (H00000825-M01)

View related products by pathway.

PTMs for Calpain 3 Antibody (H00000825-M01)

Learn more about PTMs related to Calpain 3 Antibody (H00000825-M01).

Blogs on Calpain 3

There are no specific blogs for Calpain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain 3 Antibody (1B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN3
Entrez
Uniprot