TRIM26 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRIM26 Antibody [NBP2-47594] - Staining human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TRIM26 Antibody [NBP2-47594] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM26 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGRE
Specificity
Specificity of human TRIM26 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM26 Antibody

  • Acid finger protein
  • AFP
  • RNF95RING finger protein 95
  • tripartite motif containing 26
  • tripartite motif-containing protein 26
  • widely expressed acid zinc finger protein
  • Zinc finger protein 173
  • ZNF173tripartite motif-containing 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34594
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NBP1-32914
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-58268
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Sh, Ze
Applications: WB, IHC, IHC-P
NBP2-67282
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00093659-P01
Species: Hu
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NB100-1519
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA
NB600-1468
Species: Hu
Applications: WB, IHC, IHC-P, S-ELISA
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TRIM26 Antibody (NBP2-47594) (0)

There are no publications for TRIM26 Antibody (NBP2-47594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM26 Antibody (NBP2-47594) (0)

There are no reviews for TRIM26 Antibody (NBP2-47594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRIM26 Antibody (NBP2-47594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIM26 Products

Bioinformatics Tool for TRIM26 Antibody (NBP2-47594)

Discover related pathways, diseases and genes to TRIM26 Antibody (NBP2-47594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM26 Antibody (NBP2-47594)

Discover more about diseases related to TRIM26 Antibody (NBP2-47594).
 

Pathways for TRIM26 Antibody (NBP2-47594)

View related products by pathway.

Research Areas for TRIM26 Antibody (NBP2-47594)

Find related products by research area.

Blogs on TRIM26

There are no specific blogs for TRIM26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM26