Trim22 Antibody

Images

 
Genetic Strategies: Western Blot: Trim22 Antibody [NBP1-81795] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-TRIM22 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Trim22 Antibody [NBP1-81795] - Staining of human cell line ASC TERT1 shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Trim22 Antibody [NBP1-81795] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Western Blot: Trim22 Antibody [NBP1-81795] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Trim22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
Specificity
Specificity of human Trim22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Trim22 Protein (NBP1-81795PEP)
Publications
Read Publications using
NBP1-81795 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23448979)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Trim22 Antibody

  • 50 kDa-stimulated trans-acting factor
  • E3 ubiquitin-protein ligase TRIM22
  • EC 6.3.2
  • EC 6.3.2.-
  • GPSTAF50
  • RING finger protein 94
  • RNF94stimulated trans-acting factor (50 kDa)
  • Staf-50
  • STAF50staf-50
  • tripartite binding motif 22
  • tripartite motif containing 22
  • tripartite motif protein TRIM22
  • tripartite motif-containing 22
  • Tripartite motif-containing protein 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
AF755
Species: Mu
Applications: WB, Block
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25200
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81018
Species: Hu
Applications: WB, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-81795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Trim22 Antibody (NBP1-81795)(4)

Reviews for Trim22 Antibody (NBP1-81795) (0)

There are no reviews for Trim22 Antibody (NBP1-81795). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Trim22 Antibody (NBP1-81795) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Trim22 Antibody (NBP1-81795)

Discover related pathways, diseases and genes to Trim22 Antibody (NBP1-81795). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trim22 Antibody (NBP1-81795)

Discover more about diseases related to Trim22 Antibody (NBP1-81795).
 

Pathways for Trim22 Antibody (NBP1-81795)

View related products by pathway.

PTMs for Trim22 Antibody (NBP1-81795)

Learn more about PTMs related to Trim22 Antibody (NBP1-81795).
 

Research Areas for Trim22 Antibody (NBP1-81795)

Find related products by research area.

Blogs on Trim22

There are no specific blogs for Trim22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trim22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM22