MX2 Antibody

Images

 
Western Blot: MX2 Antibody [NBP1-81018] - Analysis in control (vector only transfected HEK293T lysate) and mX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Specificity
Specificity of human MX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MX2 Recombinant Protein Antigen (NBP1-81018PEP)
Publications
Read Publications using
NBP1-81018 in the following applications:

  • WB
    4 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25043006)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MX2 Antibody

  • human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB
  • interferon-induced GTP-binding protein Mx2
  • MXB
  • myxovirus (influenza virus) resistance 2 (mouse)
  • myxovirus (influenza) resistance 2, homolog of murine
  • Myxovirus resistance protein 2
  • p78-related protein
  • second interferon-induced protein p78

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32905
Species: Hu, Bv, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF

Publications for MX2 Antibody (NBP1-81018)(6)

Reviews for MX2 Antibody (NBP1-81018) (0)

There are no reviews for MX2 Antibody (NBP1-81018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MX2 Antibody (NBP1-81018). (Showing 1 - 1 of 1 FAQs).

  1. What is the concentration of this product?
    • The concentration of our product NBP1-81018 Lot A83265 is 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MX2 Antibody (NBP1-81018)

Discover related pathways, diseases and genes to MX2 Antibody (NBP1-81018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MX2 Antibody (NBP1-81018)

Discover more about diseases related to MX2 Antibody (NBP1-81018).
 

Pathways for MX2 Antibody (NBP1-81018)

View related products by pathway.

PTMs for MX2 Antibody (NBP1-81018)

Learn more about PTMs related to MX2 Antibody (NBP1-81018).

Blogs on MX2

There are no specific blogs for MX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MX2
Entrez
Uniprot