MX2 Antibody


Western Blot: MX2 Antibody [NBP1-81018] - MX2 is localized to mitochondria in cultured cells. Western blotting of four distinct cell lines comparing endogenous MX2 expression under control conditions vs. treatment with more
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human spleen shows strong positivity in nuclear membrane in cells in red pulp.
Western Blot: MX2 Antibody [NBP1-81018] - Human glioma U87 cell lysate. WB image submitted by a verified customer review.
Western Blot: MX2 Antibody [NBP1-81018] - MX2 is localized to mitochondria in cultured cells. Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = more
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human liver shows no postivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human colon shows moderate postivity in nuclear membrane in lymphoid cells in the lamina propria.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human skeletal muscle shows no postivity in myocytes as expected.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human lymph node shows moderate positivity in nuclear membrane in non-germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MX2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Specificity of human MX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID: 30333168), and from a verified customer review. ICC/IF reported in literature (PMID: 300848227).
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MX2 Recombinant Protein Antigen (NBP1-81018PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-81018 in the following applications:

Read Publications using
NBP1-81018 in the following applications:

  • 2 publications
  • WB
    9 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25043006).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MX2 Antibody

  • human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB
  • interferon-induced GTP-binding protein Mx2
  • MXB
  • myxovirus (influenza virus) resistance 2 (mouse)
  • myxovirus (influenza) resistance 2, homolog of murine
  • Myxovirus resistance protein 2
  • p78-related protein
  • second interferon-induced protein p78


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for MX2 Antibody (NBP1-81018)(11)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using NBP1-81018 Applications Species
Elias M, Wright S, Remenyi J et al. Massively parallel reporter assays combined with cell-type specific eQTL informed multiple melanoma loci and identified a pleiotropic function of HIV-1 restriction gene, MX2, in melanoma promotion BioRxiv May 2 2019 (WB, Human) WB Human
Choi J, Zhang T, Vu A et al. Massively parallel reporter assays of melanoma risk variants identify MX2 as a gene promoting melanoma Nat Commun Jun 1 2020 [PMID: 32483191] (WB) WB
Cao H, Krueger Ew, Chen J et Al. The anti-viral dynamin family member MxB participates in mitochondrial integrity Nat Commun Feb 26 2020 [PMID: 32102993] (WB, ICC/IF, Human) WB, ICC/IF Human
Yi DR, An N, Liu ZL et al. Human MxB inhibits the replication of HCV. J. Virol. Oct 17 2018 [PMID: 30333168] (WB, Human) WB Human
Martinez-Lopez A, Martin-Fernandez M, Buta S et al. SAMHD1 deficient human monocytes autonomously trigger type I interferon Mol. Immunol. Aug 8 2018 [PMID: 30099227] (WB, Human) WB Human
Kane M, Rebensburg SV, Takata MA et al. Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2 Elife Aug 7 2018 [PMID: 30084827] (ICC/IF, Human) ICC/IF Human
Wei W, Guo H, Ma M et al. Accumulation of MxB/Mx2-resistant HIV-1 Capsid Variants During Expansion of the HIV-1 Epidemic in Human Populations. EBioMedicine 2016 Jun [PMID: 27428433] (WB) WB
Opp S, Vieira D, Schulte B et al. MxB is not responsible for the block to HIV-1 observed in IFN-alpha-treated cells. J. Virol. 2015 Dec 30 [PMID: 26719253] (WB, Human) WB Human
Sali TM, Pryke KM, Abraham J et al. Characterization of a Novel Human-Specific STING Agonist that Elicits Antiviral Activity Against Emerging Alphaviruses. PLoS Pathog 2015 Dec [PMID: 26646986] (WB, Human) WB Human
Sandler NG, Bosinger SE, Estes JD et al. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature 2014 Jul 31 [PMID: 25043006]
Show All 11 Publications.

Review for MX2 Antibody (NBP1-81018) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-81018:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot MX2 NBP1-81018
reviewed by:
WB Human 01/31/2020


ApplicationWestern Blot
Sample TestedHuman glioma U87 Cell

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MX2 Antibody (NBP1-81018). (Showing 1 - 1 of 1 FAQs).

  1. What is the concentration of this product?
    • The concentration of our product NBP1-81018 Lot A83265 is 0.2mg/ml.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MX2 Products

Bioinformatics Tool for MX2 Antibody (NBP1-81018)

Discover related pathways, diseases and genes to MX2 Antibody (NBP1-81018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MX2 Antibody (NBP1-81018)

Discover more about diseases related to MX2 Antibody (NBP1-81018).

Pathways for MX2 Antibody (NBP1-81018)

View related products by pathway.

PTMs for MX2 Antibody (NBP1-81018)

Learn more about PTMs related to MX2 Antibody (NBP1-81018).

Blogs on MX2

There are no specific blogs for MX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol MX2