MX2 Antibody - BSA Free

MX2-Antibody-Western-Blot-NBP1-81018-img0008.jpg

Western Blot: MX2 Antibody [NBP1-81018] - Human glioma U87 cell lysate. WB image submitted by a verified customer review.

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Product Discontinued

MX2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MX2
• Purity: Affinity purified

Applications/Dilutions

• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  MX2 Recombinant Protein Antigen (NBP1-81018PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MX2 Antibody - BSA Free

• human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB
• interferon-induced GTP-binding protein Mx2
• MXB
• myxovirus (influenza virus) resistance 2 (mouse)
• myxovirus (influenza) resistance 2, homolog of murine
• Myxovirus resistance protein 2
• p78-related protein
• second interferon-induced protein p78

Background

MX2 is encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral activity of a similar myxovirus resistance protein 1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MX2 Antibody (NBP1-81018)(22)

Publications using NBP1-81018

• Lin Y The study of MxB subcellular localization at different stages of cell cycle Thesis (WB, Human)
• Haoran Guo, Wanying Yang, Huili Li, Jiaxin Yang, Yuehan Huang, Yubin Tang, Shijin Wang, Fushun Ni, Weiming Yang, Xiao-Fang Yu, Wei Wei The SAMHD1-MX2 axis restricts HIV-1 infection at postviral DNA synthesis. mBio 2024-06-18 [PMID: 38888311]
• Layish B, Goli R, Flick H et al. Virus specificity and nucleoporin requirements for MX2 activity are affected by GTPase function and capsid-CypA interactions bioRxiv : the preprint server for biology 2023-11-17 [PMID: 38014352]
• Makokha GN, Chayama K, Hayes CN et al. Deficiency of SCAP inhibits HBV pathogenesis via activation of the interferon signaling pathway Virology 2023-08-01 [PMID: 37437369] (WB, Human)
• Hesham Nasser, Naofumi Takahashi, Youssef M Eltalkhawy, Omnia Reda, Sameh Lotfi, Kanako Nasu, Jun-Ichi Sakuragi, Shinya Suzu Inhibitory and Stimulatory Effects of IL-32 on HIV-1 Infection. Journal of immunology (Baltimore, Md. : 1950) 2022-09-23 [PMID: 36130125]
• Albanese M, Ruhle A, Mittermaier J et al. Rapid, efficient and activation-neutral gene editing of polyclonal primary human resting CD4+ T cells allows complex functional analyses Nature methods 2021-12-23 [PMID: 34949807] (WB, Human)
• Kurebayashi Y, Bajimaya S, Watanabe M et al. Human parainfluenza virus type 1 regulates cholesterol biosynthesis and establishes quiescent infection in human airway cells PLOS Pathogens 2021-09-16 [PMID: 34529742] (ICC/IF, Human)
• Betancor G, Jimenez-GuardeNo JM, Lynham S et al. MX2-mediated innate immunity against HIV-1 is regulated by serine phosphorylation Nature microbiology 2021-08-01 [PMID: 34282309] (WB)
• Arwert, E N, Milford, E L Et al. STING and IRF3 in stromal fibroblasts enable sensing of genomic stress in cancer cells to undermine oncolytic viral therapy. Nat Cell Biol 2020-07-01 [PMID: 32483388] (WB, Human)
• Cao H, Krueger Ew, Chen J et Al. The anti-viral dynamin family member MxB participates in mitochondrial integrity Nat Commun 2020-02-26 [PMID: 32102993] (ICC/IF, WB, Human)
• Betancor G, Jimenez-Guardeno J, Lynham S Phosphorylation of MX2 regulates innate immunity against HIV-1 Research Square 2021-01-01 (WB)
• Juraleviciute M, Nsengimana J, Newton-Bishop J et al. MX2 mediates establishment of interferon response profile, regulates XAF1, and can sensitize melanoma cells to targeted therapy Cancer medicine 2021-03-18 [PMID: 33734579] (WB, Human)
• Choi J, Zhang T, Vu A et al. Massively parallel reporter assays of melanoma risk variants identify MX2 as a gene promoting melanoma Nat Commun 2020-06-01 [PMID: 32483191] (WB)
• Yi DR, An N, Liu ZL et al. Human MxB inhibits the replication of HCV. J. Virol. 2018-10-17 [PMID: 30333168] (WB, Human)
• Elias M, Wright S, Remenyi J et al. Massively parallel reporter assays combined with cell-type specific eQTL informed multiple melanoma loci and identified a pleiotropic function of HIV-1 restriction gene, MX2, in melanoma promotion BioRxiv 2019-05-02 (WB, Human)
• Martinez-Lopez A, Martin-Fernandez M, Buta S et al. SAMHD1 deficient human monocytes autonomously trigger type I interferon Mol. Immunol. 2018-08-08 [PMID: 30099227] (WB, Human)
• Kane M, Rebensburg SV, Takata MA et al. Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2 Elife 2018-08-07 [PMID: 30084827] (ICC/IF, Human)
• Wei W, Guo H, Ma M et al. Accumulation of MxB/Mx2-resistant HIV-1 Capsid Variants During Expansion of the HIV-1 Epidemic in Human Populations. EBioMedicine 2016-06-01 [PMID: 27428433] (WB)
• Opp S, Vieira D, Schulte B et al. MxB is not responsible for the block to HIV-1 observed in IFN-alpha-treated cells. J. Virol. 2015-12-30 [PMID: 26719253] (WB, Human)
• Sali TM, Pryke KM, Abraham J et al. Characterization of a Novel Human-Specific STING Agonist that Elicits Antiviral Activity Against Emerging Alphaviruses. PLoS Pathog 2015-12-01 [PMID: 26646986] (WB, Human)
• Sandler NG, Bosinger SE, Estes JD et al. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature 2014-07-31 [PMID: 25043006]
• Kane M, Yadav SS, Bitzegeio J et al. MX2 is an interferon-induced inhibitor of HIV-1 infection. Nature. 2013-10-24 [PMID: 24121441] (WB, Human)

Review for MX2 Antibody (NBP1-81018) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 01/31/2020

Summary

• Application: Western Blot
• Sample Tested: Human glioma U87 Cell
• Species: Human
• Lot: B1C6856

FAQs for MX2 Antibody (NBP1-81018). (Showing 1 - 1 of 1 FAQs).

1. What is the concentration of this product?
   • The concentration of our product NBP1-81018 Lot A83265 is 0.2mg/ml.

Bioinformatics

• Gene Symbol: MX2
• Entrez:
  • 4600(Human)
• Uniprot:
  • P20592(Human)